KEGG   Burkholderia cepacia DDS 7H-2: DM42_7069Help
Entry
DM42_7069         CDS       T03302                                 

Gene name
xylB
Definition
(GenBank) xylulokinase
  KO
K00055  aryl-alcohol dehydrogenase [EC:1.1.1.90]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00350  Tyrosine metabolism
bced00360  Phenylalanine metabolism
bced00622  Xylene degradation
bced00623  Toluene degradation
bced01100  Metabolic pathways
bced01120  Microbial metabolism in diverse environments
bced01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bced00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DM42_7069 (xylB)
   00360 Phenylalanine metabolism
    DM42_7069 (xylB)
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    DM42_7069 (xylB)
   00622 Xylene degradation
    DM42_7069 (xylB)
Enzymes [BR:bced01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.90  aryl-alcohol dehydrogenase
     DM42_7069 (xylB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AIO43058
UniProt: A0A095EJ12
LinkDB All DBs
Position
3:765643..766770
Genome map
AA seq 375 aa AA seqDB search
MYTDNDTRAVTAAVARAAGAPFSIESARIRAPRGDEVLVRVVATGLCHTDLIVRDQYYPV
PLPAVLGHEGAGVVEAVGPNVKTLAAGDHVVLTYGACGHCTSCVGGHGAYCRQFFALNFG
GADADGQTALRDASGQPLHDHFFAQSSFASYALARENNAIKVPKEAPLELLGPLGCGIQT
GAGAVINSLAVRTGSSFASFGAGAVGMSAVMAARIAGATTIIAVDIVPSRLALALELGAT
HALNSREVDVVDAIREITGGGVDYALESTGLPAVLSQGIDALGSRGTMGVVGAPKLGTRA
EFDVNSLLLGGHTIRGIVEGDSVPQTFIPQLVQLHLQGRFPFDRLVKFYSLEQINQAAED
SSKGITLKPILRLPH
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccgacaacgatacacgcgccgtcaccgcggccgtcgcgcgcgccgccggcgcg
ccgttctcgatcgaatccgcccggatccgcgcgccgcgcggcgacgaggtgctggtgcgc
gtcgtcgcgaccggcttgtgccataccgacctgatcgtgcgcgaccagtactatccggtg
ccgctgccggccgtgctcggtcacgaaggcgccggcgtggtcgaggcggtcggcccgaac
gtgaagacgctcgccgcgggcgaccacgtcgtgctgacctacggcgcgtgcggtcactgc
acgtcgtgcgtcggcggtcacggcgcgtattgccggcagttcttcgcgctgaacttcggc
ggcgccgacgccgacgggcaaaccgcgcttcgtgacgcatccggccaaccgctgcacgat
catttcttcgcgcagtcgtcgttcgcgagctacgcgctcgcccgcgagaacaacgcgatc
aaggtgccgaaggaagcaccgctcgagctgctcggcccgctcggctgcgggatccagacc
ggcgcgggcgcggtgatcaattcgctcgcggtgcgcaccggcagcagcttcgcgagcttc
ggcgcgggcgcggtcggcatgagcgccgtgatggccgcgcgcatcgcgggcgccaccacg
atcatcgccgtcgacatcgtgccgtcgcggctcgcgctggcgctcgaactcggcgcgacg
cacgcgctcaacagccgggaagtcgacgtcgtcgacgcgatccgcgagatcaccggcggc
ggcgtcgactacgcgctcgaatcgaccgggctgccggccgtgctgtcgcaaggaatcgac
gcgctgggctcgcgcgggacgatgggcgtggtcggcgcgccgaagctcggcaccagggcc
gaattcgacgtgaacagcctgctgctcggcggccacacgatccgcggcatcgtcgaaggc
gacagcgtgccgcagacgttcattccgcagctcgtccaactgcacctgcagggccggttt
ccgttcgaccggctggtgaagttctattcgctcgagcaaatcaaccaggccgccgaggac
agcagcaaaggcatcacgctcaagccgatcctgcggttgccgcactag

DBGET integrated database retrieval system