KEGG   Burkholderia cepacia DDS 7H-2: DM42_7098Help
Entry
DM42_7098         CDS       T03302                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bced00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    DM42_7098 (ligD)
Enzymes [BR:bced01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DM42_7098 (ligD)
DNA repair and recombination proteins [BR:bced03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DM42_7098 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIO43706
UniProt: A0A088V2D2
LinkDB All DBs
Position
3:complement(802470..805316)
Genome map
AA seq 948 aa AA seqDB search
MAGKLDPYRRKRHFGATPEPEGAHGKRRAKAQTKAGTQPNAKPAARAGHPLRFVIQEHHA
RRLHYDFRLELDGTLKSWAVPKGPSFDPQVKRLAVHVEDHPLEYASFEGEIPAGHYGAGS
VVVWDEGTWTPDGGIAHAREGYRAGKLTFRLDGEKLHGGWALVRSGRQEGRQEQWLLIKE
RDDDARSADEFDVVGERPGSVHDGASHGAARKHAARRRGSNGADGANGDARAVRRESPES
PESPESPESPESPESPESPESHEGPRPTEPSQVEGAVRAPLPERVAPQLATLVDAPPTQG
GWCYELKFDGYRILARIAGKGARRRVTLMTREGRDWTAKLRAQRDALAALDVDDAWLDGE
AVVLGDNGLPDFQALQNAFGTDRSDTITFFVFDLPYLDGYDLRDAPLTARRALLEPLLAN
CDPARVRFSPDLGEDIASLIASACDTGLEGLIGKRAESRYRAGRSPAWIKLKCRRRQEFV
IGGFTEPSGSRHGFGALLLGVHEPAPAGKRRRGPGPLRYVGRVGTGFDARMLDRLAAILR
KHERDTMPFDAPPRERTRTRVHWVEPTLVAECEFAEWTGDGIVRQAAFIALRDDKPAEQI
VREMPTHTETEGAMDQRSTTQDKPRRASRTDRHASTGQARGARADADADTGDDTIGRVRI
THPERVLDPQSGTRKLDLARYWQWVAPWLLPDLKGRPVSLVRAPGDIAGELFFQKHAERR
EIPFVTQHEGLDPGHGPLLSIDSVDALLGAAQMGTVELHTWNAHASNIERPDRIVFDLDP
DPALPWRTMIDAAQLVRGLLDELGLVSFCKTSGGKGLHVVVPLTRHAGWDDVKDFSRAVA
QHVAGTLPDRFTATMGPRHRRGKIFVDYLRNGRGASTITAYSVRARPGMGVSVPLDWDEV
PATTGGAQWTIDTLHERLDTLKRDPWEGYAKTRQRITAAMRARLGADA
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagctcgatccgtatcgccgcaagcgccatttcggcgcgacgcccgagccc
gaaggcgcgcacggcaagcgtcgcgcgaaggcgcagacgaaagcggggacgcagccaaac
gcgaagcctgccgcacgcgcaggccatccgctgcgcttcgtgatccaggagcaccacgcg
cgccggctgcactacgatttccggctcgaactcgacggcacgctgaagtcgtgggccgtg
ccgaaggggccgagcttcgatccgcaggtgaagcggctcgccgtgcacgtcgaggatcat
ccgctcgaatacgcgtcgttcgaaggcgagattccggccgggcattacggggcggggtcg
gtcgtcgtatgggacgaaggtacgtggacgcccgacggcggcatcgcgcatgcgcgcgaa
ggctatcgggccggcaagctgacgttccggctcgacggcgagaagctgcacggcggctgg
gcgctcgtgcgcagcgggcggcaggaggggcgtcaggagcagtggctgctgatcaaggag
cgcgacgacgacgcgcgcagcgccgatgaattcgacgtcgtcggcgagcggccggggagt
gtgcatgacggtgcgtcccacggcgcggcgcgcaagcatgctgcgcggcgtcgcggatcg
aatggcgcggatggcgcgaatggcgatgcacgtgccgtgcgacgcgaaagccccgaaagc
cccgaaagccccgaaagccccgaaagccccgaaagccccgaaagccccgaaagccccgaa
agccacgaaggcccgcgccccaccgaaccgtcgcaagtcgaaggcgcggtgcgcgcgccg
ctgcccgagcgcgtcgcgccgcaactcgcgacgctggtcgatgcgccgccgactcagggc
ggctggtgctacgaactgaagttcgacggctatcgaatcctcgcgcgcattgccgggaag
ggcgcgcgccgacgcgtcacgctgatgacgcgcgaaggccgggactggaccgcgaagctg
cgcgcgcagcgcgacgcgcttgcggcgctcgacgtcgacgacgcgtggctcgacggcgag
gccgtcgtgctcggcgacaacggcctgccggatttccaggcgctgcagaacgcgttcggc
acggaccgttcggacacgatcactttcttcgtgttcgatctgccttatctcgacggctac
gacctgcgcgacgcgccgctcaccgcccgtcgtgcattgctcgagccgctgctcgcgaac
tgcgacccggcgcgcgtgcgcttttcgcccgatctcggcgaggacatcgcatcgctgatc
gcgagcgcctgcgacaccggcctcgaagggctgatcggcaagcgtgcggaatcgcgctac
cgcgccggccgttcgcccgcgtggatcaagctcaagtgccggcgccggcaggagttcgtg
atcggcggctttacggagccgtcgggcagccggcacggcttcggcgcgctgctgctcggc
gtgcacgaaccggcgccggccggcaaacggcgacgcgggccggggccgctgcgctacgtc
ggccgcgtcggcaccggcttcgacgcgcggatgctcgaccgtctcgccgcgatcctgcgc
aagcacgagcgcgacacgatgccgttcgatgcgccgccgcgcgaacgcacgcgcacgcgc
gtgcactgggtcgagccgacgctcgtcgccgaatgcgaattcgccgaatggaccggtgac
ggcatcgtgcggcaggccgcgttcatcgcgttgcgcgacgacaagccggcggagcagatc
gtccgcgagatgccgacacacacggaaacggagggggcgatggatcagcgttcgactacg
caggacaagccgcggcgtgcgtcgcgcaccgatcgtcacgcgagcacgggccaggcgcgc
ggcgcgcgcgccgatgccgatgccgacaccggcgacgatacgatcggccgcgtgcgcatc
acacatcccgagcgggtgctcgatccgcaaagcggcacgcgcaagctcgatctcgcgcgg
tactggcaatgggtcgcgccgtggctgttgcccgacctgaaaggccggcccgtgtcgctc
gtgcgcgcacccggcgacatcgccggcgaactgttcttccagaagcacgcggaacgccgc
gagattccgttcgtcacgcagcacgaagggctcgacccgggccacgggccgctgctgtcg
atcgacagcgtcgacgcgctgctcggcgccgcgcagatgggcacggtcgagctgcatacg
tggaacgcgcacgcgtcgaacatcgagcggcccgaccgcatcgtgttcgacctcgatccc
gacccggcgctgccgtggcgcacgatgatcgacgccgcgcagctcgtgcgcgggctgctc
gatgaactcgggctcgtatcgttctgcaagacgagcggcggcaaggggctgcacgtcgtc
gtgccgctcacgcggcatgcgggctgggacgacgtgaaggacttttcgcgcgcggtcgcg
cagcacgtcgccggcacgctgcccgaccgtttcaccgcgacgatggggccgcgccaccgg
cgcggcaagatcttcgtcgactatctgcgcaacggccgcggcgcgagcacgatcaccgcg
tattcggtgcgcgcgcggcccggcatgggcgtgtcggtgccgctcgactgggacgaggtg
cccgcgacgacgggcggcgcgcaatggacgatcgacacgctgcacgaacggctggatacg
ctgaagcgcgacccgtgggaaggttatgcgaagacgcgccagcgcatcaccgcggcgatg
cgtgcgcggctcggcgccgatgcgtga

DBGET integrated database retrieval system