KEGG   Brucella ceti TE28753-12: V568_100804Help
Entry
V568_100804       CDS       T02935                                 

Gene name
ddl_2
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bcee  Brucella ceti TE28753-12
Pathway
bcee00473  D-Alanine metabolism
bcee00550  Peptidoglycan biosynthesis
bcee01100  Metabolic pathways
bcee01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    V568_100804 (ddl_2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    V568_100804 (ddl_2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    V568_100804 (ddl_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcee01011]
    V568_100804 (ddl_2)
Enzymes [BR:bcee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     V568_100804 (ddl_2)
Peptidoglycan biosynthesis and degradation proteins [BR:bcee01011]
 Precursor biosynthesis
  Amino acid ligase
   V568_100804 (ddl_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AHB01839
LinkDB All DBs
Position
1:752974..754035
Genome map
AA seq 353 aa AA seqDB search
MASGKMRIVVLFGGRSAEHDVSVLSATNVMNALDPAKYEAVPVFVTRAGQWLLSRFVNGA
LEKPSSGAELCLVPGGCGRAIVVPDAGAPYEADKIDIIFPVLHGLHGEDGAVQGLAQVAR
VPLAGCGIPGSANALDKDIAKRLVNEAGLSTAKSVTITREEVPAFSALEQALGLPIFIKP
ARQGSSVGVHKVVTEADYQAAMSDGFTYDDKLLAEEFIQAREVECGVLEDEGGALFVSRA
GEIVPAESHCFYSYDAKYIDADGTEIKVPAELPEQVENEIRAIAAKAFRVLGCDSMARVD
FFVTADRRIVLNEINTIPGFTDMSMYSKVMAVSGVSYPEIINRLVAHGLARGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaaaaatgcgtatcgttgtcctctttggtggacgctcagcggagcatgat
gtttccgttctttcagcaaccaatgtcatgaatgcgctggatccggccaaatatgaggct
gttcctgtttttgtaacacgcgcgggacaatggctgttgagccgcttcgtgaacggtgcg
ctggaaaagccgtcaagcggcgcagagctttgccttgttccgggcggctgtgggcgtgcc
atcgtggttcctgatgccggcgctccatacgaggcggacaaaatagatatcatatttccg
gttctgcatggccttcatggggaagatggtgctgtgcaaggcttggctcaggttgcgcga
gtaccgctggcaggttgtggtattccaggttccgccaatgcactcgacaaggatattgcc
aagcgcctggtcaatgaagcgggcctgtccacggcaaaatccgtgaccatcacgcgcgaa
gaggttcccgctttcagtgcgctcgaacaggctttgggtttgcccatatttatcaaaccc
gcccgtcagggttcgtctgtcggtgtccacaaggttgtaacggaagcagattatcaggct
gccatgtccgatggtttcacttatgacgataagctgctggctgaagagttcattcaggcg
cgcgaagttgaatgcggcgttcttgaagacgaaggaggcgcgctgttcgtctcgcgcgct
ggcgagattgtgcctgcggaaagccactgtttttatagttatgatgccaaatatatcgat
gccgatggaactgagatcaaggttcctgcggagttgcccgaacaggtagagaatgaaatc
cgtgcgatcgccgccaaggctttccgggttctgggctgcgattccatggcgagggttgat
ttttttgttacggcagacaggcgtatcgtgctgaatgaaatcaacactattcccggcttc
accgatatgagcatgtattccaaggtgatggctgtgagcggtgtaagctatcctgaaatt
atcaatcgattggttgcgcatggcttggcgcggggaagctga

DBGET integrated database retrieval system