KEGG   Brucella ceti TE28753-12: V568_200172
Entry
V568_200172       CDS       T02935                                 

Definition
(GenBank) Soluble lytic murein transglycosylase proteins (some containing LysM/invasin domains)
Organism
bcee  Brucella ceti TE28753-12
SSDB
Motif
Pfam: SLT Glucosaminidase
Other DBs
NCBI-ProteinID: AHB02958
LinkDB
Position
2:168996..169625
AA seq 209 aa
MADRVRRDVNMRIVRRSPKMAVALLISVVAVWLSDAPLAQAENICEREMHRASARYGVPL
GILYAVGLTETGRKNSLQPYAMNIEGKAEFPPSQSAAIRRFGEVRAEGAKLIDLGCMQIN
YHYHSQAFPSVAAMLMPSLNVDYAARFLKRLREREGNWTMAVARYHAGPNNDPAQKRYVC
RVMANMVATGFGNWTPQARSFCFSRGGLL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcggatcgggtcaggcgggacgtgaacatgcgaatagtcaggcgaagcccgaaaatg
gccgtggcgctcctcatatcggtggtcgcggtctggttgtctgatgcaccattggcgcag
gcggaaaatatctgcgagcgggaaatgcaccgggcatcggcccgttacggcgttccgctc
ggtattctctatgccgtgggcctgaccgaaacaggccgcaagaattcgctgcaaccctat
gcgatgaatattgagggaaaggccgaattcccgccctcgcaatcggccgcaatcaggcgt
tttggcgaagtgcgggccgaaggcgcgaagctgattgatcttggttgtatgcagatcaac
tatcattaccacagtcaggcctttccctccgtggcggcaatgctaatgccgagcctgaat
gtggactatgcggcgcgctttttgaagcggcttcgagaacgggaaggcaattggaccatg
gctgtcgcgcgttatcatgccgggccgaataacgatcccgcgcagaagcgttatgtctgc
cgcgtgatggcgaatatggtggcaacgggctttggaaactggacgcctcaggcacgaagc
ttctgtttcagccgcggcgggcttttgtaa

DBGET integrated database retrieval system