KEGG   Bacillus cereus FT9: BcrFT9_00613Help
Entry
BcrFT9_00613      CDS       T03417                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BcrFT9_00613
Enzymes [BR:bcef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BcrFT9_00613
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BcrFT9_00613
    1.1.1.-  
     BcrFT9_00613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C TrkA_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AIE78178
UniProt: A0A068N3I6
LinkDB All DBs
Position
767382..768434
Genome map
AA seq 350 aa AA seqDB search
MKALLWHNQRDVRVEEVPEPTVKPGAVKIKVKWCGICGTDLHEYLAGPIFIPTEEHPLTH
VKAPVILGHEFSGEVVEIGEGVTSHKVGDRVVVEPIYSCGKCEACKHGHYNVCEQLVFHG
LGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHAVRQSKLKEGEAVAVFGC
GPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLNPATQDVLAEIRNLTNGLG
VNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITPNNLVLKEKEVVGILGYRHI
FPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDKTQVKILVSPK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattactttggcataatcaacgtgatgtaagagtagaagaagtaccagaacca
actgtaaaaccaggagcagttaagattaaagttaaatggtgtggtatctgcgggacagac
ctgcatgaatatttagcaggacctatttttattcccacagaagagcatccattaacacat
gtaaaagcaccggttattttaggtcatgagtttagcggtgaggtagttgaaatcggtgaa
ggcgttacatctcataaagtgggagaccgcgtcgttgtagaaccaatttattcttgtggt
aaatgtgaagcttgtaaacatggacattacaatgtttgtgaacaacttgttttccacggt
cttggcggagaaggcggcggtttctctgaatatacagtagtaccagaagatatggttcac
catattccagatgaaatgacatatgaacaaggtgcacttgtagaaccagcagctgtagca
gttcatgcagtacgtcaaagtaaattaaaagaaggggaagctgtagcagtatttggttgt
ggtccaattggacttcttgttatccaagcagctaaagcagcaggagcaactcctgttatt
gcagtcgagctttctaaagaacgtcaagagttagcaaaattagcaggtgcggattacgta
ttaaatccagctactcaagatgtattagcagaaattcgtaacttaacaaatggtttaggt
gtaaatgtgagctttgaagtaacaggtgttgaagtagtacttcgtcaagcgattgaaagt
acaagtttcgaaggacaaactgtaattgttagtgtatgggaaaaagacgcaacaattact
ccgaataacttagtattaaaagaaaaagaagtggttggtattttaggataccgtcatatc
ttcccagctgttattaaattaattagctctggccaaattcaagcagagaaattaattacg
aaaaaaattacagtagatcaagttgttgaagaaggatttgaagcacttgtaaaagataaa
acacaagtgaaaattcttgtttcacctaaataa

DBGET integrated database retrieval system