KEGG   Bacillus cereus FT9: BcrFT9_01693Help
Entry
BcrFT9_01693      CDS       T03417                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00473  D-Alanine metabolism
bcef01100  Metabolic pathways
bcef01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BcrFT9_01693
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BcrFT9_01693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcef01011]
    BcrFT9_01693
Enzymes [BR:bcef01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BcrFT9_01693
Peptidoglycan biosynthesis and degradation proteins [BR:bcef01011]
 Precursor biosynthesis
  Racemase
   BcrFT9_01693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIE79235
UniProt: A0A068N925
LinkDB All DBs
Position
2074488..2075663
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATIPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAIVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgagtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcgaaagctgctattgaagcagga
ataaatcagcttgcagttgcgtttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacgtcagtagcagctgcggaagaagcaattcaa
tatgacgtaatgatgactgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaggttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtaggaatgtttacacattactctacggcagatgaaattgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgtcaatacagcaaaagaattaggaattcat
atcccatatattcatagttcaaatagtgcaggatcaatggagcttagcaatacatttcaa
aatatggttcgtgtcgggatcggaatttatggaatgtatccttcaaaagaggtagatcat
tcagttgtttctctgcagcctgcgttgtcgttaaaatcaaaagtagctcatattaagcat
gcaaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccactataccgattggttatgcggatggctataaccgtcagttatctaataaaggg
catgcattaataaatggggttcgagtacctgttattggtcgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaatattgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagacagaagaattccacgtgtatataaagaaaataatgaa
acgactgctattgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system