KEGG   Bacillus cereus FT9: BcrFT9_02099Help
Entry
BcrFT9_02099      CDS       T03417                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00250  Alanine, aspartate and glutamate metabolism
bcef00410  beta-Alanine metabolism
bcef00430  Taurine and hypotaurine metabolism
bcef00650  Butanoate metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef02024  Quorum sensing
Module
bcef_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bcef00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BcrFT9_02099
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BcrFT9_02099
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BcrFT9_02099
   00430 Taurine and hypotaurine metabolism
    BcrFT9_02099
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BcrFT9_02099
Enzymes [BR:bcef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BcrFT9_02099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIE79640
UniProt: A0A068NA97
LinkDB All DBs
Position
complement(2560119..2561600)
Genome map
AA seq 493 aa AA seqDB search
MPQDRKAEVQKHAYERKEIMPDNSQSLPRHMQKELPHEFSVNPLFAREGESVVPRFHISD
EGMLPETAYQIVHDEITLDGNARLNLATFVSTWMEPAAEQLYAKSFDKNMIDKDEYPQTA
EIEERCVRILANLWHSPSPLTTMGVSTTGSSEACMLGGLALKRRWQNARKSEGKPLDRPN
IVFSSAVQVVWEKFANYWEVEPRYVKVSPEHPQLDPQGVLAAVDENTIGVVPILGETYTG
LYEPVAEIAKALDDLQARTGLDIPMHVDAASGGFIAPFLQPDLVWDFQLPRVKSINVSGH
KYGLVYPGLGWIIWREAEDLPEDLIFRVSYLGGNMPTFALNFSRPGAQVLLQYYNYLRLG
KSGYYDIQRASQKVALFLSKAIQKMEPFELLSDGSDIPVFAWRLKEGYTSNWNLYDLSRQ
LRVFGWQVPAYPLPPDMESVTIMRVVVRNGFSMDLAHLFLRNLKQTVAFLDFLYGPMLVK
IAIAIPLRFNFSG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggatcgaaaagcagaagttcaaaaacatgcatatgaaagaaaagagattatg
ccagataattcacaatctctaccgcgtcacatgcaaaaagagctacctcacgaattttct
gtaaatcctctgtttgcccgcgaaggagaatccgtcgttccgcgttttcatatatctgat
gaaggtatgttaccagaaacagcgtatcaaatcgtccatgatgaaattactcttgatggc
aacgcccgcctaaatcttgcaacattcgttagcacatggatggagcctgccgcagagcaa
ctatatgcaaaatcattcgacaagaacatgattgataaggacgaatatccacagacagct
gaaattgaggagcggtgtgtgcgtatcttagccaacctctggcattcgccaagccccctt
acgactatgggcgtttcaacaactggatcgtcagaagcatgtatgctcggtgggcttgct
ctaaagcgacgctggcaaaatgcacgtaaaagtgaagggaagccgttggatcgtcccaat
attgtgtttagttcggctgttcaggtcgtttgggaaaaattcgcgaactattgggaggtt
gaaccacgctatgtaaaggttagcccagaacatccccaattggatcctcagggggttctc
gcagccgtggatgaaaatacgattggtgtggtaccgattctcggtgaaacttataccggt
ctttacgaaccggttgccgaaattgcaaaagcgttagatgatttacaggcgagaacgggt
cttgacattcccatgcatgtagatgcagcttcaggaggatttatagcaccgtttcttcaa
ccagatttagtctgggattttcaattaccgagagtgaaatccatcaatgtatccggacat
aaatatggattagtctatcctggattgggttggataatttggcgggaagctgaagatctc
cctgaggatctaatcttccgtgtctcctatttaggcgggaacatgccaacctttgccctg
aatttctctcgtcctggcgcacaagtgctcctacaatattacaattacctgcgtttgggg
aaaagtgggtactatgatatacaaagggcttcccagaaagtcgctctatttcttagcaaa
gccattcagaagatggaaccattcgaacttttgtccgatggctcggatattccggttttc
gcttggcgactaaaagaaggttacacatcaaattggaatctttatgatttatctcgacaa
ttacgtgtgttcggttggcaagtacccgcctatccattgcctccagatatggaatctgtg
acaattatgcgcgttgtggttcgaaatggattttccatggatctcgcacatttatttttg
cgaaacctcaaacagaccgttgcctttctggattttttatacgggcctatgctggtaaaa
atagcaatagctattcccttaaggtttaatttttcgggttaa

DBGET integrated database retrieval system