KEGG   Bacillus cereus FT9: BcrFT9_03577Help
Entry
BcrFT9_03577      CDS       T03417                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00020  Citrate cycle (TCA cycle)
bcef00190  Oxidative phosphorylation
bcef00650  Butanoate metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef01130  Biosynthesis of antibiotics
bcef01200  Carbon metabolism
Module
bcef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcef_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BcrFT9_03577
   00650 Butanoate metabolism
    BcrFT9_03577
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BcrFT9_03577
Enzymes [BR:bcef01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BcrFT9_03577
    1.3.5.4  fumarate reductase (quinol)
     BcrFT9_03577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_17 Fer4_2 Fer4 Fer4_4 Fer4_3 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIE81110
UniProt: A0A063CND4
LinkDB All DBs
Position
complement(4297845..4298606)
Genome map
AA seq 253 aa AA seqDB search
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNQTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaaaacaatccgcctcatcattacgagacaagacggaccagacgcgcaagcg
tttgatcaagagtttgaaattccataccgtccgaatatgaatattatttcggcgcttatg
gaaatacgtcgtaaccctgttgattcaaaaggaaaccagacaactccgattgcatgggat
atgaactgtttagaagaagtatgtggcgcatgttcgatggtgattaacggaaaaccacgt
caatcatgtacagcgcttatcgatcaattagaacaaccaattcgcttaaagccgatgaag
acattcccagttgtacgtgacttacaagttgaccgtagtcgcatgtttaatgctctaaaa
cgtgttaaagcttggattccaattgatggtacgtatgacttaggaccaggaccaagaatg
ccagagaagaaacgtcaatgggcttatgagctttcaaaatgtatgacatgtggtgtttgc
ttagaatcatgtccaaacgtaaatagcaaatcggactttattggaccagcaccgttatcg
caagctcgtttattcaactcacatccaacgggtgaaatgcataaagcagatcgcttacgt
gcgattatgggtgatggaggacttgcaaactgtggtaactctcaaaactgtgtgcaatca
tgtccaaagggtattccattaaccacttcaattgcggcgttaaaccgtgatacaacaatt
caatcgttcaaagatttctttggtagcgataataactattaa

DBGET integrated database retrieval system