KEGG   Bacillus cereus FT9: BcrFT9_03578Help
Entry
BcrFT9_03578      CDS       T03417                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00020  Citrate cycle (TCA cycle)
bcef00190  Oxidative phosphorylation
bcef00650  Butanoate metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef01130  Biosynthesis of antibiotics
bcef01200  Carbon metabolism
Module
bcef_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcef_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BcrFT9_03578
   00650 Butanoate metabolism
    BcrFT9_03578
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BcrFT9_03578
Enzymes [BR:bcef01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BcrFT9_03578
    1.3.5.4  fumarate reductase (quinol)
     BcrFT9_03578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_8 Not3
Motif
Other DBs
NCBI-ProteinID: AIE81111
UniProt: A0A063CR11
LinkDB All DBs
Position
complement(4298599..4300392)
Genome map
AA seq 597 aa AA seqDB search
MKGKLIVVGGGLAGLMATIKAAEAGVNVELFSLVPVKRSHSVCAQGGINGAVNTKGEGDS
PWIHFDDTIYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTEEGLLDFRRFGGTQH
HRTAFAGATTGQQLLYALDEQVRRHEVAGLVTKYEGWDFLRAVVDDEGVCRGIVAQDLQT
MEIRSFRADAVIMATGGPGIIFGKSTNSIINTGTAASAVYQQGAYYANGEFIQIHPTAIP
GDDKLRLMSESARGEGGRVWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVEQKL
GINGENMVYLDLSHKDPKELDIKLGGIIEIYEKFTGDDPRKLPMKIFPAVHYSMGGLWVD
YKQMTSIPGLFAAGECDYSMHGGNRLGANSLLSAIYGGMVAGPNAIEYMKGLSKSSDAVS
STVYEQNELIETEKFNNILTLDGNENAYVLHKELGEWMTDNVTVVRENKKLLETDAKIEE
LMARYKRININDTARWSNQGASFTRQLANMFELARVITIGAYNRNESRGAHYKPEFPNRD
DANFLKTTMAKFEGEGNAPAFHYEDVDVSLIKPRKRDYSSKHDVAAKNEEKGDKQHV
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggaaacttatagtagtcggcggtggcttggctggcttaatggcaacgattaaa
gcggcggaagcaggagtaaatgttgaactgttctctttagtaccagtaaaacgttcgcat
tctgtatgtgcccaaggtggaattaacggtgccgtaaatacgaaaggtgaaggggattct
ccatggatccactttgacgatacaatttatggtggggacttcttagcgaaccaaccacca
gttaaagcaatgtgtgaagcagcacctggtatcattcatttaatggaccgtatgggtgtt
atgttcaaccgtacggaagaaggacttcttgatttccgtcgttttggtggaacgcaacat
caccgtacagcatttgctggtgcaacaactggacagcaattactatacgcattagatgag
caagtacgtcgtcacgaagtagcaggacttgtaacgaaatatgaaggttgggatttctta
cgagctgttgttgatgatgaaggtgtgtgccgaggaatcgttgcacaagacttacaaact
atggagattagaagtttccgagctgatgccgtgattatggcaacagggggccctggtatc
atcttcggaaaatcaacaaactccattatcaatacaggtacagcagcttctgctgtatat
caacaaggcgcatattatgcaaacggtgagttcattcaaattcacccaacggcaattcct
ggagacgataaattacgtcttatgagtgaatctgcacgtggtgaaggtggacgtgtttgg
acatataaagatggtaaaccatggtacttcttagaagaaaaatatccggcttacggaaac
cttgtacctcgtgatattgcaacgcgtgaaatctttgatgtttgcgtagagcaaaaacta
ggtattaacggtgaaaacatggtgtacttagatctttctcataaagatccgaaagaacta
gatattaaacttggtggaattattgaaatctatgagaaatttacaggtgacgatcctcgt
aaactaccaatgaaaatcttcccagctgttcactattcaatgggtgggctatgggttgat
tataagcagatgacaagcattccaggtttatttgcagcaggtgagtgtgattattctatg
cacggtggtaaccgtcttggtgcgaactcattattatcagcaatttacggtggtatggta
gcaggaccgaatgcaattgaatatatgaaaggtctttctaaatcatcagatgctgtttca
tctactgtgtatgaacaaaatgaattaatcgaaacagagaaatttaacaatattttaacg
ctcgatggtaatgaaaatgcgtatgttcttcataaagagcttggagaatggatgacagat
aacgttacagtagttcgtgaaaataaaaagttattagaaacagatgcaaaaattgaagag
ttaatggctcgttacaaacgtattaacattaacgatacagcgagatggagtaaccaaggt
gcttcatttacacgtcaacttgcaaatatgtttgagttagcgcgtgttattacaattggc
gcatataaccgtaatgagagtcgtggggcgcattacaaacctgaattcccaaatcgtgat
gatgctaacttcttaaaaactacgatggcgaaatttgaaggagaaggaaatgcaccggca
ttccattacgaagacgtggatgtttcgttaattaaaccacgtaaacgtgattattcttca
aaacacgatgtagctgctaagaacgaagagaagggggataaacaacatgtctga

DBGET integrated database retrieval system