KEGG   Bacillus cereus FT9: BcrFT9_03645Help
Entry
BcrFT9_03645      CDS       T03417                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00010  Glycolysis / Gluconeogenesis
bcef00030  Pentose phosphate pathway
bcef00051  Fructose and mannose metabolism
bcef00052  Galactose metabolism
bcef00680  Methane metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef01130  Biosynthesis of antibiotics
bcef01200  Carbon metabolism
bcef01230  Biosynthesis of amino acids
bcef03018  RNA degradation
Module
bcef_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BcrFT9_03645
   00030 Pentose phosphate pathway
    BcrFT9_03645
   00051 Fructose and mannose metabolism
    BcrFT9_03645
   00052 Galactose metabolism
    BcrFT9_03645
  09102 Energy metabolism
   00680 Methane metabolism
    BcrFT9_03645
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BcrFT9_03645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bcef01009]
    BcrFT9_03645
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bcef03019]
    BcrFT9_03645
Enzymes [BR:bcef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BcrFT9_03645
Protein phosphatases and associated proteins [BR:bcef01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BcrFT9_03645
Messenger RNA biogenesis [BR:bcef03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BcrFT9_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AIE81178
UniProt: A0A068NC18
LinkDB All DBs
Position
complement(4384533..4385492)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMDEVIARLKRGSERGKKHSIIVVAEGVGSAIDFGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQNNKLVDHDIIEAL
AQKHTIDKDMCQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaactaggttctgttggcgatatt
atccaccgcggtggtacgaaattatatacagcaagatgtcctgagtttaaagacccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccatgtgtt
ggtgtaccaggtacaatcgacaatgatatccctggaacagactttacaattggtttcgat
acagctttaaatactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagctgatggtgcggagacaatcttaattccagaagaagagtatgacatggatgag
gttatcgctcgtctgaaacgtggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacttcggtaagcacattgaagaagcaacaaacttt
gatactcgtgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagtcgtcttggtgcaagagcagttgaattgttaattgctggtaaaggt
ggacgttgtgtaggtattcaaaataataaacttgttgatcatgacattatcgaagcgtta
gctcaaaaacatacaatcgataaagatatgtgtcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system