KEGG   Bacillus cereus FT9: BcrFT9_03690Help
Entry
BcrFT9_03690      CDS       T03417                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00270  Cysteine and methionine metabolism
bcef00450  Selenocompound metabolism
bcef01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BcrFT9_03690
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BcrFT9_03690
Enzymes [BR:bcef01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BcrFT9_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIE81223
UniProt: A0A068NC56
LinkDB All DBs
Position
complement(4435236..4435631)
Genome map
AA seq 131 aa AA seqDB search
MKKKHMETALIHHGYTSKEHKGSLTPPLFQTSTFTFETAQQGEASFAGVDPSYIYSRLGN
PTVKLFEERMAVLEVGEEALAFGSGMAAISATLIGFFKSWRSYYLFKWIIRMHVRLFGSV
RRKIYDYAFVL
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaagcatatggagacagcgttaattcatcacggttatacatcaaaggaacat
aaaggaagtttgacaccgcctttatttcaaacgtctacatttacatttgagactgcgcag
caaggagaggcgagttttgcgggagtggatccatcttatatttactcaagacttggaaat
ccgactgtgaaattatttgaagaacgtatggcggtattagaagtaggagaagaagcgctt
gctttcgggtccggtatggcagctatttcagcaacgttaattggcttttttaaaagctgg
agatcatattatttgttcaaatggattatacggatgcacgtacggctttttggaagtgtt
agaagaaaaatttatgattacgcattcgttttgtga

DBGET integrated database retrieval system