KEGG   Bacillus cereus FT9: BcrFT9_03999Help
Entry
BcrFT9_03999      CDS       T03417                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bcef  Bacillus cereus FT9
Pathway
bcef00071  Fatty acid degradation
bcef00280  Valine, leucine and isoleucine degradation
bcef00281  Geraniol degradation
bcef00362  Benzoate degradation
bcef00592  alpha-Linolenic acid metabolism
bcef01100  Metabolic pathways
bcef01110  Biosynthesis of secondary metabolites
bcef01120  Microbial metabolism in diverse environments
bcef01130  Biosynthesis of antibiotics
bcef01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bcef00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BcrFT9_03999
   00592 alpha-Linolenic acid metabolism
    BcrFT9_03999
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BcrFT9_03999
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BcrFT9_03999
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BcrFT9_03999
   00642 Ethylbenzene degradation
    BcrFT9_03999
Enzymes [BR:bcef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BcrFT9_03999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIE81506
UniProt: A0A063CMK6
LinkDB All DBs
Position
complement(4744275..4745447)
Genome map
AA seq 390 aa AA seqDB search
MREAVIVAGARTPIGKAKRGSLKTVRPDDLGALVVKETLKRANYEGPIDDLIFGCAMPEA
EQGLNMARNIGGLAGLSYDVPAITINRYCSSGLQSIAYGAERIMLGHSEAVLSGGAESMS
LVPMMGHVVRPNSRLVEAAPEYYMGMGHTAEQVAVKYGISREEQDAFAVRSHQRAAKALA
AGNFADETVSVDVTLRTVGSNNKLQEETIIFAQDEGVRAETTLDILGKLRPAFNVRGSVT
AGNSSQMSDGAASVLLMDREKAVSDGMKPLAKFRSFAVAGVPPEVMGIGPIAAIPKALKL
AGLELSDIGLFELNEAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLI
HEMKRRNEQFGIVTMCIGGGMGAAGVFELL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagctgtcattgttgcgggagcaagaacaccaattggaaaagcaaagaggggt
tcattaaaaacagttcgtcctgacgatctaggggcgttagtagtaaaggaaacgttaaag
cgtgcgaattatgaaggaccaatcgatgatttaattttcggttgtgcgatgccagaagca
gagcaaggtttaaatatggctcgtaatatcggcggattagcaggactttcttacgatgtt
ccagctattacaattaaccgttactgttcttcaggtttacaaagtatcgcttacggagca
gagcgcattatgcttggtcactcggaagcggtattatcaggcggagcggaatcaatgagt
ttagttccgatgatgggacacgtcgttcgtccgaatagtcgccttgtagaagcggctcca
gaatattatatgggtatgggacatacagcagagcaagttgctgtgaaatatggaatttct
cgtgaagagcaagatgcatttgcagtaagaagtcatcaacgtgctgcgaaagcattagct
gcaggaaactttgctgatgaaacagtatctgtagatgtaacgttacgtactgttggatca
aataacaaactgcaagaagaaacaatcattttcgcacaagacgaaggtgtaagagcagaa
acgacgctagacattttaggtaaattacgtccagcatttaacgttcgcggttctgtaaca
gctggtaactcttcacaaatgagtgacggtgcagcatctgtactattaatggatcgtgaa
aaagcagtgagcgatggcatgaaaccacttgcgaaattccgttcatttgcagtagctggc
gtaccaccagaagtaatgggaattggcccaatcgctgcaattccaaaagcgttaaaacta
gctggcttagagctatctgatattggcttattcgaactaaatgaagcattcgcttctcaa
tcgatccaagttattcgtgaacttggtttagatgaagaaaaagtaaacgtaaacggcggt
gcaattgcacttggacatccacttggctgtacaggagcaaaactaacactatctcttatt
cacgaaatgaaacgccgcaacgaacaattcggtatcgtaacaatgtgtatcggcggcgga
atgggagcagcgggagtatttgaattactataa

DBGET integrated database retrieval system