KEGG   Bacteroides cellulosilyticus: BcellWH2_02435Help
Entry
BcellWH2_02435    CDS       T04116                                 

Definition
(GenBank) Retaining alpha-galactosidase precursor
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bcel  Bacteroides cellulosilyticus
Pathway
bcel00500  Starch and sucrose metabolism
bcel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BcellWH2_02435
Enzymes [BR:bcel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BcellWH2_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C DUF1073
Motif
Other DBs
NCBI-ProteinID: ALJ59674
UniProt: A0A0P0GP15
LinkDB All DBs
Position
complement(2988996..2991140)
Genome map
AA seq 714 aa AA seqDB search
MKHSLFIAFFLCLGSFASAQQLTSPDGNLSLEFMEQADGVPAYRLDYKGKPVLTSGRLGL
LTEEADLTRGFKQTNLERASVDNYWNPVWGEYNRVRNHYNEMTVTLEQPETGRILNIRFR
LFNDGLGFRYELPLQRKMNYLTVKDEVTEFNLTGNHKAFCIPGDYDTNEFAYTTAPLSDI
AVDMEKRIAKKSYESKAEGGLTVQTPLMMKSEDGIYLNIHEAALVDYAGMLLNVDDKQFK
LSAHLTPDKLGKKGYLQLPVLSPWRTVIVSDDARDILASQLIYNLNEPCQYEDTSWIRPM
KFVGVWWEMFTGEGKTWAYSDFYQAKPGITDYAKLKPNGHHPANTAHVKEYIDFASAHGI
DGILVEGWNEGWEDWASYRKDRQFLFNKAYPDFDVKELQRYAKEKGVQMVMHHETAANAA
DYERQLDEAFQFMVDNGYHAVKTGYVGYIIPRNEYHSSQWMNNHYIHVARRAADYKVMVN
SHEAVRPTGLCRTYPNWLAQESARGGEFETMGGNDPDHTCILPFTRLKGGPMDYTPGIFE
TRLSYYNGEKPNERVHTTLVKQMALYMTMPSPIQMVADLPSNYARFPDAFRFIEDVAVDW
DNSWYLEAEPGDYITVARKAKGKNEWFVGGITDENSRTATIPFSWLPEGKQYIATIYEDG
KDADWDTNPQSYRIRKVVVTPKSVLKQKLAASGGVAISIKEADKAEMKGLKTIR
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattctctttttattgcctttttcctttgcctcggttcgttcgcctcggcccag
caactcacttctcctgacggtaacctgtcattggagtttatggagcaggcagacggcgtt
ccggcataccggctggactataaaggcaaacccgttttaacttccggtcgtttaggtctc
ctgacggaagaagccgacctgacccgaggattcaaacaaacaaaccttgaacgtgcttct
gttgataactactggaatcccgtttggggtgagtacaaccgggtacggaatcattataac
gaaatgaccgtcaccttagaacaaccggaaacgggacgtatcctaaatatccgttttcgt
ctgttcaatgatggtctgggctttcgctacgaactgcctttgcaacgcaagatgaactac
ctcaccgtaaaagatgaagtaaccgaattcaatctcacgggaaatcataaagccttttgc
atccccggtgactatgataccaacgagtttgcctataccaccgcccctctatcggacatc
gcagtggatatggagaaaagaattgccaagaaatcttatgaatctaaagccgaaggcggc
ctgacagtgcaaaccccgttaatgatgaaaagcgaagatggcatctacctgaatatccat
gaagctgctttagtggattatgccggtatgttgctaaatgtagatgataagcagtttaaa
ttaagtgcccacctgactcccgataaattaggtaagaaaggttacttgcaactgcccgtg
ctgtctccctggcgtaccgttattgttagcgatgatgcccgtgacattcttgcttctcaa
ttgatttataatctgaacgaaccttgccaatatgaagatacctcttggattcgtccgatg
aaattcgtcggcgtgtggtgggaaatgttcacaggcgaaggaaagacctgggcatatagt
gatttctaccaggccaaacccggcattacggattatgccaaactgaaacccaatggtcat
catcccgccaataccgcccatgtgaaggaatatatcgacttcgcctccgcccatggcatc
gacggaatactggtagaaggctggaacgaaggttgggaagactgggcttcttaccggaaa
gaccgtcagttcctcttcaacaaagcctatcccgacttcgacgttaaagagctgcaacgt
tacgccaaagaaaaaggcgtgcaaatggtgatgcatcacgaaacagccgccaatgctgcc
gactacgaacgccaattggatgaggccttccagttcatggtagacaatggttatcatgct
gtgaaaaccggttacgtaggttatatcatcccccgtaatgaataccactcttcccaatgg
atgaacaaccattacatccatgtagcccgtcgcgctgctgattataaagtaatggttaat
agccacgaggcagtacgccccaccggtttgtgtcgtacttaccctaactggctggctcag
gaatctgcccgtggcggagagttcgaaacaatgggtggcaatgatcccgatcatacctgt
attctgccttttacccgcctgaaaggtggtccgatggactataccccgggtattttcgag
acaagactgtcttattacaacggtgagaaacccaacgaacgtgtgcataccactttggtg
aagcaaatggcactctacatgaccatgccttctcctatccagatggtagccgacttgcct
tccaattacgcccgtttcccggatgccttccgattcattgaagacgttgcggtagattgg
gacaatagctggtacctggaagctgaaccgggagattatatcaccgtagcccgcaaggcg
aaaggtaaaaacgaatggtttgttggcggcattactgatgagaatagtcgtacggcgacg
attcctttctcctggcttccggaaggaaaacaatatatcgctaccatttacgaagatggc
aaggatgcagattgggacaccaatccccaaagctatcgtatacgtaaggtagtagtgaca
cctaagagtgtattgaaacagaaattagccgccagcggtggcgttgccatcagcatcaaa
gaggctgataaagcggagatgaaaggtttgaaaaccatccgctaa

DBGET integrated database retrieval system