KEGG   Bacteroides cellulosilyticus: BcellWH2_02613Help
Entry
BcellWH2_02613    CDS       T04116                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcel  Bacteroides cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BcellWH2_02613 (ahpF)
Enzymes [BR:bcel01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BcellWH2_02613 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA HI0933_like FAD_binding_2 Thioredoxin_3 FAD_oxidored Thi4 AlaDh_PNT_C NAD_binding_8 DAO NAD_binding_7 FAD_binding_3 Thioredoxin_4 Lycopene_cycl K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALJ59852
UniProt: A0A0P0G0L0
LinkDB All DBs
Position
3230127..3231686
Genome map
AA seq 519 aa AA seqDB search
MLETSILNQVRSVFQNLETQYTFHITCHPRHESAQELTELLKDVAGCSDKLSCEVTETEE
PKLEFSLLKNGKETGVKFRGIPNGHEFTSLLLAVLNADGKGKNLPDEAISRRIQALKGPI
SLQTYVSLTCTNCPDVVQALNIMALLNGQVTHEMIDGALFQEEVDALKIQGVPSVYANGK
LLHVGRGTLGELLQKLEEMFGSEPMGNAESISRTYDVLVLGGGPAGASAAIYSARKGLRV
AIVAEKVGGQVKETVGIENLISVPQTTGAQLADNLRSHINHYPIDLFEDRKIEKAELQGK
EKRISVVGGEVFISPSVIIATGASWRKLNVDGETEYIGRGVAFCPHCDGPFYQGKDVAVI
GGGNSGIEAAIDLAGICRKVTVFEFADTLKADQVLQEKAKSLPNVEIFTSSQTTKVVGNG
DKVTAIRVKDRVSSEERDFPLDGIFVQIGLAANSAPFRDMLETTPIGEIKIDAFCRTTLP
GVYAAGDVSNVPYKQIVIAMGEGAKAALSAFDDRIRGIA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaacaagcattttaaatcaagtacgcagcgtcttccaaaacctggaaacgcag
tacacttttcatatcacctgccatccccggcacgaaagcgcacaggaactgacagagttg
ctgaaagatgtagcaggatgttccgataaactctcctgtgaggtaactgaaaccgaagaa
ccgaagttggaattctctttgctgaaaaacgggaaagaaaccggtgtcaaattccgcgga
ataccgaacggtcatgaattcacatctttgcttctggcagtactgaatgccgatggaaag
gggaaaaatcttcctgatgaagccatcagccgacgtatccaggcgttgaaaggacctatt
tcattgcagacttatgtatcattgacatgtaccaactgccccgatgtggtgcaggccctg
aatataatggctttgctgaacggacaggtcacacacgaaatgatagacggtgctcttttc
caagaagaagtggatgcattgaaaatacaaggcgtaccgtccgtctatgccaacggtaaa
ttgcttcatgtaggacgcggcaccttaggcgaacttctgcaaaagctggaagaaatgttc
ggctccgaacctatgggaaatgcagaatctatctcacggacttatgatgtccttgtatta
ggcggtgggccggcaggtgcctcagctgcgatttattcagcccgcaagggattacgggta
gctattgtagctgaaaaagtcggtggtcaggtaaaggaaaccgtaggaatcgagaacctg
atttccgtaccgcagactacaggtgcacagttggcagacaatttaagaagccatatcaat
cattatcccatcgacttgtttgaagaccgtaaaatagagaaggcggagcttcaaggaaaa
gaaaagaggatttcagtagtgggcggtgaagtattcatatctcccagtgttatcatcgcc
accggtgcaagctggcgcaaactaaatgtggatggtgaaacggagtatataggcagagga
gtagccttttgtccgcattgcgacgggccgttctatcagggaaaagacgtagccgttatc
ggtggaggaaactccggtatagaagcagccatcgacttggcaggtatctgccggaaagtg
actgtctttgaatttgcggatacactgaaagctgaccaggtactgcaagaaaaggcgaaa
agcttgccgaatgtagaaatcttcacttcttcacagaccacaaaggtagtgggaaacggt
gataaggtaacagctatccgcgtcaaagatcgtgtaagtagtgaagaacgggatttccca
ttggatggtatcttcgtacagattggtttggcagccaatagcgctcctttccgtgacatg
ctggaaacgactccaataggcgaaatcaagatcgacgctttttgccgcaccacacttccg
ggagtttatgcggcaggagatgtctcgaacgttccctacaaacagatagtaattgcaatg
ggtgaaggtgcaaaggcggcactgtcagcatttgatgaccgcatccggggaattgcataa

DBGET integrated database retrieval system