KEGG   Bacteroides cellulosilyticus: BcellWH2_02967Help
Entry
BcellWH2_02967    CDS       T04116                                 

Gene name
bgaA_2
Definition
(GenBank) Beta-galactosidase BgaA
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
bcel  Bacteroides cellulosilyticus
Pathway
bcel00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BcellWH2_02967 (bgaA_2)
Enzymes [BR:bcel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BcellWH2_02967 (bgaA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M ABC_transp_aux Glyco_hydro_42C
Motif
Other DBs
NCBI-ProteinID: ALJ60205
UniProt: A0A0P0GJP8
LinkDB All DBs
Position
3760417..3762486
Genome map
AA seq 689 aa AA seqDB search
MKTEKHVVILWLIISLLLPTLACAQYKFDNVLYGAAYYHEYMPTDRLDKDIQMMKDCGLS
VVRVGESSWGLFEPREGEFEFAWMDRIIDKMHQAGIKVILGTPTYAIPAWMAEKHPDVLT
TYERGNKAYYGTRQNMDISNPAYLFYSERIIRKMMEHYANHPAIIGYQVDNEATARGTNN
HDFFVGFRSYIKEKFDNDLDSLNKAWGLNYWSMNIHSWEEFYTRDGVTNPSYKNEWERYG
RKRIADFLNWQVDIVNEYKRKDQFVTHCFMPAFHEIDQVESFRQMEYPAINPYHSVQDGQ
NGRLISYSGDHMRTVAKGNYLITETNAQTTGWDARYQYPPYDNQLRQNVYSHLASGANMV
EYWHWHSIHYGQETYWKGILGHDLEPNRIYHEFTAVAKELKNIGSKLVNLKKKNDVAILY
SHDSYYGLRFMPYTHGDNYPVEMLHSSLYNMNIETDIVHCDKVSDFSEYKMLIIPPLYIA
TDELLEKIDAFVKNGGKVIMMYKSGYCNEHSAVRAMLAPGPLRKACGFYYQESSTIGWME
LKDNPFGLDNKKAIGEIIEFIIPETAQPLAYADHPFFGKWPVITENSYGKGSLVYIASYP
SQELFEKIVRTEAEKAGIVSDDEYKFPIIVKKGTNDKGRTIRYIFNYSPTSQEVEYNYAS
KGKELLKNRTLSKGDSMTIAPWDLLIVEE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagaaaaacatgttgttatcctttggctaatcatatcattattgctgcctaca
cttgcctgtgcgcagtataaatttgataatgtactgtatggggcggcttattatcatgaa
tacatgccgacagatcgattggataaagatatccaaatgatgaaagattgtggactttca
gttgttcgtgtcggagaatcatcgtggggcttgtttgaacctcgtgaaggcgagtttgaa
ttcgcatggatggaccggataatagataagatgcatcaggcaggtataaaagtaattttg
ggaactcccacttatgctataccagcctggatggcagaaaaacatccggatgtgttaact
acttacgaacgaggcaataaggcatattatggaacccgccagaatatggatatatcgaat
cccgcctatttgttctacagtgagcgtatcattcgcaaaatgatggagcactatgccaat
catcctgccattatcggatatcaggtggataatgaagctactgcacgtggaactaataat
catgacttttttgttggattcagaagctatattaaagagaagtttgataatgatctggat
tctttaaacaaagcctggggcctgaattattggagtatgaacattcatagttgggaagag
ttctataccagagatggtgttactaatccctcgtacaaaaatgagtgggaacgttatggc
cgtaaaaggattgctgattttctgaattggcaggtagatattgtcaatgaatacaaacgg
aaagatcaatttgtaacacattgttttatgcctgcttttcatgaaatagatcaggtggaa
agttttcgtcagatggagtatcctgcgattaatccatatcatagtgtgcaagatggccag
aatggcaggttaatatcatattcgggcgaccacatgaggactgttgctaaaggcaactat
ctgataactgaaacgaatgctcaaaccaccggttgggatgcgaggtatcaatatccgcct
tatgataatcagctcagacaaaatgtatattcacatttggcatccggggcaaacatggta
gaatattggcactggcactctatacattatggtcaagagacctactggaagggaattttg
ggacatgatcttgaaccaaaccgcatttatcatgagtttactgccgtggcaaaagaattg
aagaatataggtagtaaattggttaatcttaaaaagaagaatgacgtagctattctttac
agtcatgattcgtattatggattaagattcatgccttatactcatggagataattatccg
gttgaaatgttgcactcttcgctttataatatgaatatagaaacggatattgttcattgc
gataaagtgagtgatttctcggaatataaaatgttgattatacctcctctctatattgct
accgatgaactgttggaaaagatagatgctttcgtgaaaaatggtggtaaggttatcatg
atgtataagagcggttactgtaatgaacattctgcggttagagctatgttggctcccggt
cctttacgtaaagcatgtggattttattatcaggagagttctacaattggatggatggag
ctgaaagataatccgttcggactagataataagaaggctattggtgaaattatagaattc
attatacccgaaacagcccaacctttggcttatgctgatcatcctttcttcgggaagtgg
cctgtaataactgagaatagttatggtaaaggatcactggtatatattgcttcatatcct
tcgcaagagttgtttgagaagatagttcgtacagaggcagaaaaggctggcattgtttcc
gatgatgaatataaattccctataatagtgaagaaaggaacgaatgataaaggtcgtact
attcgctatatatttaattattcaccgacttctcaagaggtggaatacaattatgcatcc
aagggaaaggaactgctgaagaacaggacattgagcaaaggcgattcgatgacgattgct
ccatgggatttgttgattgttgaagagtga

DBGET integrated database retrieval system