KEGG   Bacteroides cellulosilyticus: BcellWH2_03402Help
Entry
BcellWH2_03402    CDS       T04116                                 

Gene name
tufA
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bcel  Bacteroides cellulosilyticus
Brite
Translation factors [BR:bcel03012]
 Eukaryotic Type
  Elongation factors
   BcellWH2_03402 (tufA)
 Prokaryotic Type
   BcellWH2_03402 (tufA)
Mitochondrial biogenesis [BR:bcel03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BcellWH2_03402 (tufA)
Exosome [BR:bcel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BcellWH2_03402 (tufA)
  Exosomal proteins of breast cancer cells
   BcellWH2_03402 (tufA)
  Exosomal proteins of colorectal cancer cells
   BcellWH2_03402 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Gtr1_RagA
Motif
Other DBs
NCBI-ProteinID: ALJ60632
UniProt: A0A0P0GTJ8
LinkDB All DBs
Position
4423649..4424833
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERKKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSEVKSFDQIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPKLVVFMNKCDMVDDEEMLELVEMEMRELLAAYEFDGDNTPIIRGSALGALN
GVEKWEDKVMELMDAVDNWIPLPPRDIDKPFLMPVEDVFSITGRGTVATGRIEAGIIHVG
DEVEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKESIKRGMVLCKPGQIK
PHSKFKASIYVLKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVEIN
VELIYPVALNVGLRFAIREGGRTVGSGQITEILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaattcgaacgtaaaaaaccgcacgtaaacatcggtacaatcggtcac
gttgaccacggtaaaaccacgttgactgctgctatcactacagtgttggcaaagaaaggt
ctttcagaagttaagtctttcgatcagattgataatgctcctgaagaaaaagaaagaggt
atcactattaatacttctcacgtagagtatgaaaccgctaatcgtcactatgctcacgta
gactgtccgggtcacgccgactacgtaaagaacatggtaactggtgctgctcagatggat
ggtgctatcatcgtagttgctgctactgatggtccgatgcctcaaactcgtgaacatatc
ttgttggctcgtcaggtaaatgtaccgaagcttgttgtattcatgaacaagtgtgatatg
gttgacgatgaagaaatgttggaacttgttgagatggaaatgcgcgaattactcgctgca
tacgaatttgacggtgacaatactcctatcatccgtggttctgctcttggtgcattgaat
ggtgtggaaaaatgggaagacaaagttatggaattgatggatgcagttgataattggatt
ccgttgcctccgcgtgacattgataaaccattcttgatgccggttgaagacgtattctct
attactggtcgtggtactgttgctactggtcgtatcgaagctggtatcatccacgtaggt
gatgaagttgaaatcctcggtctgggtgaagataagaaatctgttgtaactggtgttgaa
atgttccgcaaattgctggatcagggtgaagctggtgataacgtaggtttgttgcttcgt
ggtattgataaagaatctatcaaacgtggtatggttctttgtaaaccgggtcagattaaa
cctcactctaaattcaaagcttctatctatgttttgaagaaagaagaaggtggtcgtcat
actccgttccataacaaataccgtcctcaattctatctgcgtactatggactgtacaggt
gaaatcactcttccggaaggaactgaaatggtaatgcctggtgataacgtagaaattaac
gtagaattgatctatccggtagctttgaacgtaggtttgcgttttgctatccgtgaaggt
ggtcgtacggtaggttctggtcagattactgaaatccttgactaa

DBGET integrated database retrieval system