KEGG   Bacteroides cellulosilyticus: BcellWH2_03909Help
Entry
BcellWH2_03909    CDS       T04116                                 

Gene name
fabF_2
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase 2
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
bcel  Bacteroides cellulosilyticus
Pathway
bcel00061  Fatty acid biosynthesis
bcel00780  Biotin metabolism
bcel01100  Metabolic pathways
bcel01212  Fatty acid metabolism
Module
bcel_M00083  Fatty acid biosynthesis, elongation
bcel_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bcel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BcellWH2_03909 (fabF_2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BcellWH2_03909 (fabF_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcel01004]
    BcellWH2_03909 (fabF_2)
Enzymes [BR:bcel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     BcellWH2_03909 (fabF_2)
Lipid biosynthesis proteins [BR:bcel01004]
 Fatty acid synthase
  Component type
   BcellWH2_03909 (fabF_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ALJ61130
UniProt: A0A0P0GMJ0
LinkDB All DBs
Position
complement(5058019..5059209)
Genome map
AA seq 396 aa AA seqDB search
MKIYVTGLGVVSGIGLGVAENIASLRKHQHGMGKVTLFPTELDVPVSEVKYSNEELKRLL
SLDIQKTFSRTALLGMLAAREAVDDARLDLNTLRVGLISSTSVGGMDLSEHFYNAFKKDN
RKGRLREVISHDCGASTEMIADYLKVNDFVTTISTACSSAANAIMLGARMIRNGQLDAAI
VGGTDALCKFTLNGFNSLMILDKEHCRPFDASRAGLNLGEGAGYIVLQSEKLLRKESYCL
LSGYSNVNEAFHQTGSSPEGNGPFWSMTEAIAKSEIPPEEIDYINVHGTGTPSNDLSEGL
AIRRIFGDKIPPFSSVKAFIGHTLGASEGIEAVYSVLSVYHGFIYPNLNFKEPIEENMLM
PETSFREGLPIRNVLSNSFGFGGNDSSILFSTLKEK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatatgtaaccggtttaggtgttgtttcaggtattggtctgggggttgcagaa
aatatagcttcactcaggaaacatcagcatggtatggggaaagtcactcttttccctacg
gaactggatgtacccgtatcagaggtaaaatacagcaatgaagaactaaaacggttactc
tctttagatatacaaaaaacgttttcccggacagccttattaggtatgttagctgcccgg
gaagcagtcgatgacgcccggttagatttgaatactttgcgtgtaggtctcatatcttcc
acttctgtaggtggtatggatttgagtgaacatttctacaatgcctttaaaaaagacaat
agaaaaggaagattacgggaagtcatctctcatgactgcggtgcaagtactgaaatgata
gcggattatctgaaagtaaatgactttgtaaccactatcagtaccgcctgttcatcagca
gctaatgctatcatgttaggagcccgcatgatcaggaatggccaactggacgctgccatt
gtaggaggtacggatgccttgtgcaagtttaccctcaacggtttcaattcacttatgatt
ttggataaggaacactgccgtccttttgacgcatcccgtgcaggcctcaacttaggagaa
ggagccggatatattgtccttcaatcagagaaattactccggaaagagtcttattgctta
ttaagcggatattcgaatgtgaatgaagcttttcatcaaaccggcagttcacccgaagga
aacggaccattctggtctatgacagaagccatagcaaagagtgaaattcctcccgaagag
attgattatatcaatgtacatggcacaggaactccaagtaatgatctttcagaaggactt
gctatccgacggatttttggtgataaaattcctccgttcagttctgtcaaagcgtttatc
ggtcatacattaggggcttcggaaggaattgaagcggtttattctgttctctccgtatat
catggtttcatctatcccaatctgaacttcaaagaacctatagaagaaaacatgttgatg
cccgaaacctcattccgcgagggactacccattcgtaatgtactatcgaattcttttgga
ttcggtggaaatgattcttcgatcctgttttccacattaaaagagaaatga

DBGET integrated database retrieval system