KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2511Help
Entry
DM39_2511         CDS       T03308                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00620  Pyruvate metabolism
bcen00680  Methane metabolism
bcen00710  Carbon fixation in photosynthetic organisms
bcen01100  Metabolic pathways
bcen01120  Microbial metabolism in diverse environments
bcen01200  Carbon metabolism
Module
bcen_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM39_2511
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM39_2511
   00680 Methane metabolism
    DM39_2511
Enzymes [BR:bcen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM39_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIO31241
UniProt: A0A088U1V9
LinkDB All DBs
Position
1:2735484..2738468
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARTTRRNAALPSTDAPTSTVTTAANGRAKPATKPKATIPQTKRAAGAAKPAART
REDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDHEAAQTLEKK
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYALDQLKTT
GNASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQELTARERQHNE
AMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIEAALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQSAVILEHYLEQVHKLGAELSVSNLLV
GANDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRLGEGTVPVRSAGRGAPP
VRATPYADSDEFVADLKVLTASLAEHHGASLAAPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVVAELFARAGVEADYAGLAEEDKQRVLLAALADPRPLRSPYIEYSALAQSELGVFE
KARDVRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLLDGTLGTPDGHARSGLMVIP
LFETIPDLRDASRIMREYFALPGVEALIAHQGGEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVELFRARKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDEAMAAYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRRIEDLRAIPWGFSWGQCRLLLTGWYG
FGSAVSAYLDGAGDAAERGKRLALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADRKLRKHVFERIVAEWERTSQALAEITGHEGRLATNPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacgacacgccgcaatgctgccctgccctccaccgac
gctccgacgagcaccgtcaccaccgccgcgaacggtcgtgcgaaaccggcaacgaaaccg
aaagccacgatacctcagacaaaacgcgcggccggcgcggcgaagcccgccgcacgcacg
cgcgaggacaaggaccgcccgctgttcgaggacatccgcttcctcggccgcctgctcggc
gacgtggtgcgcgaacaggaaggcgacaccgtgttcgacgtcgtcgagacgatccgccag
accgccgtcaagttccgccgcgaggacgaccacgaggccgcgcagacgctcgagaagaag
ctgcgcaagctgacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
catctcgcgaacatcgccgaggaccgtcatcacaaccgtcgccgccgcatccacgcgctg
gccggctcggcgccgcagccgggcacggtggcctatgcgctcgaccagctgaagacgacc
ggcaatgcatcgaagcgcctgctgcagcgcttcttcgacgacgcgctgatcgtgcccgtg
ctgaccgcgcacccgaccgaggtgcagcgcaagagcatcctcgacgcgcagcacgacatc
gcgcggctgctcgccgaacgcgaccaggaactgaccgcgcgcgagcgccagcacaacgaa
gcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacccgcatgctgcgcgacgcgcgc
ctgaccgtcggcgacgagatcgagaacgcgctgtcgtactaccgcgcgaccttcctcgac
gaactgcccgcgctgtacggcgacatcgaggccgcgctcgccgagcacggcctgcccgcg
cgcgtgcccgcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtgacggccgcgacgctcgacgaggcgatcaaccgccagtcggcggtgatcctcgag
cactacctggaacaggtgcacaagctcggcgccgagctgtcggtgtcgaacctgctggtc
ggcgcgaacgacgcggtgaaggcgctcgcggcggcctcgcccgaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcatctacacgcggctcgccgcgagtgcg
cgcgtgcgtctcggcgaaggcacggtgccggtgcgcagcgccggacgcggcgcgccgccg
gtgcgcgcgacgccgtacgcggattccgacgaattcgtcgccgacctgaaggtgctgacc
gcatcgcttgccgagcatcacggcgcgtcgctcgccgcgccgcgcctcgcgccgctgatg
cgcgcggccgaggtgttcggcttccatctcgcgagcatcgacctgcgccagagctcggac
atccacgaggcagtggtcgccgagctgttcgcgcgcgcgggcgtcgaggccgactacgcg
gggctcgccgaggaagacaagcagcgcgtgctgctggcggcgctcgccgacccgcgcccg
ctgcgctcgccgtacatcgaatactcggcgctcgcgcagagcgagctcggcgtgttcgag
aaggcgcgcgacgtgcgcgcgcagttcggcgcacgcgcggtgcgcaactacatcatctcg
catacggaaacggtcagcgacctcgtcgaggtgctgctgctgcagaaggaaaccgggctg
ctcgacggtacgctcggcacgcccgacggccatgcgcgcagcggcctgatggtgatcccg
ctgttcgagacgatccccgacctgcgcgacgcgtcgcgcatcatgcgcgagtacttcgcg
ctgccgggcgtcgaggcgctgatcgcgcaccagggcggcgagcaggaagtgatgctcggc
tactcggacagcaacaaggacggcggcttcctgacgtcgaactgggagctgtaccgcgcc
gagctcgcgctcgtcgaactgttccgtgcgcgcaagatcacgctgcggctgttccacggc
cgcggcggcacggtcggccgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
ccgggcaccgtgaacggccagatccgcctgaccgaacagggcgaggtgatcgcgagcaag
ttcgcgaaccccgagatcggccggcgcaacctcgagacggtggtcgccgcgacgctcgag
gcgtcgctgctgccgcagtcgaacgcacccgcgcaactgcccgcgttcgaggccgcgatg
cagacgctgtccgacgaggcgatggccgcgtaccgtgcgctcgtctacgaaacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcacggagatcgccgagctgaacatcggc
agccgtccggcgtcgcgcaagctgcaggacccgaagaaccgccggatcgaggatctgcgc
gcgattccgtggggcttctcgtggggccagtgccggctgctgctgaccggctggtacggc
ttcggcagcgcggtgagcgcgtacctcgacggcgcgggcgacgcagccgagcgcggcaag
cggctcgcactgctgaagaagatgaacaagacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcggtcgcctcgcgctatgcgcagctg
gtggccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgccgagtgggagcgc
acctcgcaggcgctcgcggaaatcaccgggcacgaaggccgcctcgcgaccaacccgctg
ctcgcgcgttcgatcaagaaccgcttcccgtacctcgacccgctgaaccatctgcaggtc
gaactgatcaagcgacaccgcgcgggcgataccaacgcgcggctgcgccgaggcattcac
ctgacgatcaacgggatcgcggccggcctgcgcaacacgggctga

DBGET integrated database retrieval system