KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2611Help
Entry
DM39_2611         CDS       T03308                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00020  Citrate cycle (TCA cycle)
bcen00480  Glutathione metabolism
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
bcen01130  Biosynthesis of antibiotics
bcen01200  Carbon metabolism
bcen01210  2-Oxocarboxylic acid metabolism
bcen01230  Biosynthesis of amino acids
Module
bcen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcen_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DM39_2611 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM39_2611 (icd)
Enzymes [BR:bcen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DM39_2611 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIO32065
UniProt: A0A088U3G1
LinkDB All DBs
Position
1:complement(2844153..2845409)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFNGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGGEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggat
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgatgcggcggtggcgcacgcttacaaa
ggcaaacgcaagatccactggatggagatcttcgcgggcgagaaggcgaccaaggtgtac
ggtccggacgtgtggctgccggacgagacgctgcaggtgctgaaggagtacgtggtgtcg
atcaaggggccgctgacgaccccggtcggcggcgggatccgttcgctgaacgtcgcgctg
cgccaggagctcgacctgtacgtgtgcctgcgcccggtccagtacttcaacggcgttccg
tcgccggtgcgcgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggcggccggctcggagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgtttcccggaaacgtcggggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgcctggtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctcttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcggcgagatcgtgatcaag
gattcgatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcggcatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcaccgcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggaccgaagcggccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctcgggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system