KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2628Help
Entry
DM39_2628         CDS       T03308                                 

Definition
(GenBank) iron/manganese superoxide dismutase, alpha-hairpin domain protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Brite
Enzymes [BR:bcen01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DM39_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AIO31929
UniProt: A0A088UR36
LinkDB All DBs
Position
1:complement(2863488..2864066)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYAEDALAPTISKETIEYHYGKHHQAYVTNLNNLIPGTEFENLPLEEIVKKS
SGGIFNNAAQVWNHTFFWNSLSPNGGGAPTGALGDAINAKWGSFDAFKEAFTKAAVGTFG
SGWAWLVKKADGSLDIVSTSNAATPLTTADKPLLTIDVWEHAYYIDYRNARPKFVEAFWN
IANWDFAAKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggctcatacgctcccgccgctcccgtacgctgaagacgcactcgcgccgaccatctcg
aaagagacgatcgagtaccactacggcaagcatcaccaggcttatgtgacgaacctgaac
aacctgatcccgggcacggaattcgaaaacctgccgctggaagagatcgtgaagaagtcg
tcgggcggtatcttcaacaacgccgcgcaagtctggaatcacacgttcttctggaacagc
ctgtcgccgaacggcggcggcgctccgaccggcgcgctcggcgacgcgatcaacgcgaag
tggggttcgttcgacgcgttcaaggaagcgttcacgaaggccgcggtcggcacgttcggt
tcgggctgggcatggctcgtgaagaaggccgacggttcgctcgacatcgtgtcgacgagc
aacgccgccacgccgctgacgaccgccgacaagccgctgctgacgatcgacgtgtgggaa
cacgcgtactacatcgactaccgcaacgcacgtccgaagttcgtcgaagcgttctggaac
atcgcgaactgggacttcgcagcgaagaatttcgcgtaa

DBGET integrated database retrieval system