KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_2982Help
Entry
DM39_2982         CDS       T03308                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00550  Peptidoglycan biosynthesis
bcen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DM39_2982
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcen01002]
    DM39_2982
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcen01011]
    DM39_2982
Enzymes [BR:bcen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DM39_2982
Peptidases and inhibitors [BR:bcen01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DM39_2982
Peptidoglycan biosynthesis and degradation proteins [BR:bcen01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DM39_2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIO33874
UniProt: A0A088UWY7
LinkDB All DBs
Position
1:complement(3242001..3243311)
Genome map
AA seq 436 aa AA seqDB search
MRLSSQGLKSLASSIAFGTAARNVALGVMLPVALASTIVVAEAKPAAKAKAAHAAPAAEQ
FTGAPATFMPGAVPPPGVNARSWVLVDATSNTVLASGNADERVEPASLTKLMTAYLVFEA
LDKKKISMEQIVTPSEAVRRVGRDESRMFIEANKPVSVHDLVYGMIIQSGNDAAIALAEL
VGGSEAQFVTMMNDEAQRLGMKGTHFADVNGMPDPNHYTTAGDLAKLSAHLIRDFPQYYG
IFSEKEFKYNNIRQGNRNRLLWLDPTVDGLKTGHTQAAGYCLIASSKRAIPGSDGQRRLV
SVMMGEQKESDRTQDSMKMLNYGYSAFDAVRLFKGGQAISTPRLYKGKENTVQVGVKSDQ
WVTVPRGLGDKVKPEVDVNAPLIAPLAEGQQVGTVKIVADGKTLSEFPVVALQAVPEAGI
FGRIWDSILLMFSKKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgtcttcccaaggcctcaagtccctcgcttcctccatcgccttcggcaccgcc
gcgcgcaacgtcgcgctcggcgtgatgctgcccgtcgcgctcgcgtcgacgatcgtcgtc
gccgaggcgaagccggccgccaaggccaaggccgcgcatgcggcgcccgccgccgagcag
ttcaccggcgcgcccgcgaccttcatgccgggcgcggtgccgccgccgggcgtgaacgcg
cgctcgtgggtgctcgtcgatgcgaccagcaacaccgtgctcgcgtcgggcaatgcggac
gaacgcgtcgagccggcgtcgctgaccaagctgatgaccgcgtacctcgtgttcgaggcg
ctcgacaagaagaagatctcgatggagcagatcgtcacgccgagcgaagcggtgcgccgc
gtcggccgcgacgagtcgcgcatgttcatcgaggcgaacaagccggtgtccgtgcacgac
ctcgtgtacgggatgatcatccagtcgggtaacgacgcggcgatcgcgctggccgaactg
gtcggcggcagcgaagcgcagttcgtcacgatgatgaacgacgaggcgcagcgcctcggc
atgaagggcacgcacttcgccgacgtgaacggcatgcccgacccgaaccactacacgacg
gccggcgacctcgcgaagctgtccgcgcacctgatccgcgattttccgcagtactacggc
atcttctcggagaaggaattcaagtacaacaacatccgccagggcaaccgcaaccgtctg
ctgtggctcgacccgacggtcgacggcctgaagacgggccatacgcaggcggccggctac
tgcctgatcgcatcgtccaagcgcgcgatcccgggctcggacggccagcgccgcctcgtg
tcggtgatgatgggcgagcagaaggaaagtgaccgcacgcaggacagcatgaagatgctg
aactacggctacagcgcattcgacgcggtgcgcctgttcaagggcggccaggcgatctcg
acgccgcgcctctacaagggcaaggagaacaccgtgcaggtcggcgtgaagagcgaccag
tgggtgaccgtgccgcgcggcctcggcgacaaggtcaagccggaagtcgacgtgaacgcg
ccgctgatcgcgccgctcgccgaaggccagcaggtcggcaccgtgaagatcgtcgccgac
ggcaagacgctgtccgaattcccggtcgtcgcgctgcaggccgtgccggaagcgggtatc
ttcggtcgtatctgggactcgattctgctgatgttcagcaagaagaagtaa

DBGET integrated database retrieval system