KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_3036Help
Entry
DM39_3036         CDS       T03308                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DM39_3036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcen02000]
    DM39_3036
Enzymes [BR:bcen01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DM39_3036
Transporters [BR:bcen02000]
 Other Transporters
  Pores ion channels [TC:1]
   DM39_3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AIO33645
UniProt: A0A088U7Z9
LinkDB All DBs
Position
1:3306169..3306792
Genome map
AA seq 207 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGAVYELVPIDLRSHEQGSDAFIQVNPMAKLPALDDSGGG
GAPFAESGAVLLYLADRCPDAGLGIAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGN
PVAFGWGNIARVQRALAQTLAHSPWLVGDHFTAADLLLASTLKIAFDAHLLPHEGVLGDY
VARAEDRDGYRRAAAIEQREAARLLHA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaaaacccgggcgttccgggcgctatggatgctcgaggag
attggcgccgtctacgagctcgtgccgatcgacctgcgctcgcacgaacagggcagcgac
gcgttcatccaggtcaacccgatggccaagctgcccgcgctcgacgacagcggcggcggc
ggcgcaccgttcgccgaatcgggcgccgtgctgctttatctggccgatcgctgcccggat
gccgggctcggcatcgcgcccgacgatccgctgcgcggccgcttcctgcagtggatgttc
ttcacgccgacctgcctcgaaccggcgatggccgagaaattcaccggcgcgtcgggcaac
ccggtcgcattcggctggggcaacatcgcgcgcgtgcagcgcgcactcgcgcagacgctc
gcccatagcccctggctcgtcggcgaccacttcaccgcggccgacctgctgctcgccagc
acgctgaagattgcgttcgatgcgcacctgctgccgcacgaaggcgtgctcggcgactac
gtcgcacgcgccgaggatcgcgacggctaccgtcgcgcggccgcgatcgaacagcgcgaa
gcggcgcgcctgctgcatgcgtga

DBGET integrated database retrieval system