KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_3753
Entry
DM39_3753         CDS       T03308                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00440  Phosphonate and phosphinate metabolism
bcen00998  Biosynthesis of various secondary metabolites - part 2
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM39_3753 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM39_3753 (aepX)
Enzymes [BR:bcen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM39_3753 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AIO34438
UniProt: A0A088UB30
LinkDB
Position
2:437212..438900
AA seq 562 aa
MNAREPNFTESRSARLRRMLVSDELEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQSVAREIHENQTLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHASTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTEPTNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNV
RGAGVDRLKAMLATLQARDDFDTLDIPALLNELIAAGEKIEVQYVHGHWRGVNDLEDFRR
AGDFAHGQTPMSEPGAGNGGAR
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcgacgagctcgaattcctgatggaagcccacaacggcctgtccgcgcgcatcgtg
cgcgaagccggcttcaagggcatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaggcaagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaagacgaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgaccccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgcccaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcgtcggcgatgcagtccgtcgcccgcgaa
atccacgagaaccagacgctgatcaacgtcgaggatcgcgtcgcgtcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcctcgaacgcggcgatcgtgctcgccgcgagccgcggcaaggggctggaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagaagcatggcgtgaacgacatcaccgtggtcggcggctatcgc
gcggatgcgatcgacacgtcgggcatcaagctcgtcgtcaacgaacgccatgcatcgacc
ggcgaactcgcatcgcttgcctgcgcggccgagcgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgaa
ttcagcgtcgtcgtcgattcgtcgctgaccgagccgaccaaccagagcgtgcgcgatttc
gcgctgtgctcggcggccgacgatcgcggcctgttcggccagaagacgtatctgcagcgc
gtatcgagcgacgtcgccgcgggcacgccgcacggccgctggatcggcctgctgaacgtg
cgcggcgccggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgcgacgat
ttcgacaccctcgacatccctgcgctgctcaacgaactgatcgccgccggcgagaagatc
gaggtgcagtacgtgcacggccactggcgcggcgtcaacgatctcgaagacttccgccgc
gcgggcgacttcgcgcacggccagacgccgatgtccgagccgggcgccggcaacgggggc
gcacgatga

DBGET integrated database retrieval system