KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_3784Help
Entry
DM39_3784         CDS       T03308                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM39_3784 (ahpF)
Enzymes [BR:bcen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM39_3784 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_binding_3 Glutaredoxin FAD_oxidored NAD_binding_7 K_oxygenase Thi4 DAO NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AIO35923
UniProt: A0A088UF72
LinkDB All DBs
Position
2:478444..480042
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLDEIASLTTRVTVIERRDDDA
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALHGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQDEVETRQIMAVPTMFLNGES
FGQGRSSVKEILAKLDTGAGARAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYEVDIMDVQRADALIPGDVHQ
VRLANGAVLKAKTIVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGSQLRADEVLQRKLRTLSNVTIVTDAQTTELTGDGNRL
NGIVYQDRRSGDVKRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDYLIRQDATPAAATQPQAEEAIAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactgaaagcgtacctcgaaaagatcacgcgcccg
atcgaactcgtcgcatcgctcgacgacagcgcgaagtcgcaggagctgctggcgctgctc
gacgagattgcgtcgctgacgacacgcgtgaccgtaatcgaacgccgcgacgacgatgcg
cgcaagccgtcgttctcgatcggcgaacccggcaagccggccggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgctcgcgctgctgcagaccggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctccacggcgactacgcg
ttcgaaacgtatttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgtcacgtcgcgatcgacggcgcgctgttccag
gacgaagtcgagacgcgccagatcatggccgtgccgacgatgttcctgaacggcgaatcg
ttcggccagggtcgcagcagcgtgaaggaaatcctcgcgaagctcgataccggcgccggc
gcgcgcgccgcgaagtcgctcgaaaacaagcccgtgttcgacacgctgatcgtcggcggc
ggccccgcgggcgccgcggccgcgatctactcggcgcgcaagggcatcgcgacgggcgtg
gtggccgagcgcttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaaggaccgaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gaagtcgacatcatggacgtgcagcgcgcggacgcgctgattcccggcgacgtccatcag
gtccgcctcgcaaacggcgcggtgctgaaggcgaagacgatcgtgctcgcgaccggcgca
cgctggcgcgaaatcggcgtgccgggcgagcgcgaataccgcaatcgcggcgtcgcgtac
tgcccgcactgcgacggcccgttgttcaagggcaagcgcgtcgcggtagtcggcggcggc
aactccggcgtcgaggccgcgatcgatctcgcgggcatcgtgaaggaagtcacgctgatc
gaatacggttcgcaactgcgcgcggacgaagtcctgcagcgcaagctgcgcaccctgtcg
aacgtgacgatcgtcaccgacgcgcagacgaccgaactgaccggcgacggcaacaggctg
aacggaatcgtctaccaggatcgtcgctcgggcgacgtgaagcggatcgacctcgaaggc
gtgttcgtacagatcggcctcgtgccgaataccgaatggctgaagggcacggtcgagctg
tcgaagcatggcgagatcgtcgtcgacgcgcgcggtgcgacgtcggtgcccggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtcggcgaaggc
gcgaaggcatcgctcggcgcattcgactacctgatccgtcaggatgcgacaccggcggcg
gccacgcagccgcaggccgaggaagcgatcgccgcgtaa

DBGET integrated database retrieval system