KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4957Help
Entry
DM39_4957         CDS       T03308                                 

Definition
(GenBank) helix-turn-helix domain protein
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC HTH_31
Motif
Other DBs
NCBI-ProteinID: AIO36558
UniProt: A0A088UH19
LinkDB All DBs
Position
2:complement(1768816..1769796)
Genome map
AA seq 326 aa AA seqDB search
MTNSTVLSCTHGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVTKTDLALPGLG
IADIRGQEHVIERSPALVRQLPKEALFACQIVSGRAYFIQHDRCLLAEAGDIVVYDTRVP
YLFGFLTPMRQLLIDIPIAMIDRRLEAELALLPLKISPRPGAGEMLGTTLRASVERFMKT
PVEGDAARFSECTRTLVAELIDAEVNGVRASRTSLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLSRLFAAEGESVTQHIWSERLLHAYRELTDARLRKTSVGEIAFRWGFSSQA
HFSRAIRDRYGASPMALRDAARTADR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttctttcatgcacgcacggctcgaccgccgacgtgccggcgcgc
gaccggatggcgtactgggatgcattcaacgcggcgacgctggtcggcctgcgctgttcg
tcgctgtcgccggcggggctcgaggtcacgaagaccgacctggcgctgccgggcctcggg
atcgccgacattcgcggacaggagcacgtgatcgagcgcagcccggcgctcgtgcgccag
ttgccgaaggaagcgctgttcgcgtgccagatcgtcagcggacgcgcgtatttcatccag
cacgaccgctgcctgctggcggaagccggcgacatcgtcgtctacgacacgcgcgtcccc
tatcttttcggattcctgacaccgatgcggcagctgctgatcgacatcccgatcgcgatg
atcgaccgccggctcgaagcggaactggcgttgctgccgctgaagatctcgccgcggccc
ggtgcgggtgagatgctcggcaccacgctgcgcgcgagtgtcgagcgcttcatgaagacg
cccgtcgagggcgacgcggcgcgcttctccgagtgcacgcgcacgctggtcgcggaactg
atcgacgccgaggtgaacggcgtgcgcgcctcgcgcacgtcgctgtcgtatctgctgacc
gcgaagcagtacatcgcgacccatctcggcgagccggaacttgggccgcaggccgtcgcc
gatgcggtcgggctgtcgctgcgccacctgagccggctgttcgccgccgagggcgagtcg
gtcacgcagcacatctggtcggaacggctgctgcatgcttaccgcgagctgacggatgcg
cgcctgcgcaagaccagcgtcggcgagatcgcgttccgctggggattttcgagccaggcg
catttcagccgcgcgattcgcgatcggtatggcgcgtcgccgatggcgctgcgcgacgcg
gcgcgcacggccgaccgctga

DBGET integrated database retrieval system