KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4958Help
Entry
DM39_4958         CDS       T03308                                 

Definition
(GenBank) cupin domain protein
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AIO35732
UniProt: A0A088UGP0
LinkDB All DBs
Position
2:1769973..1770506
Genome map
AA seq 177 aa AA seqDB search
MVDQAVTEFWQNIAPIANPFKPDALPEVYIANAVTEDERYYVPFTETVSSRPLWISPTQN
KWCDILMAKQAGLVNRHYHPHEVFAYTISGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaccaagccgtcaccgaattctggcaaaacatcgcgccgattgccaatccgttc
aagcccgatgcgctgccggaagtctacatcgcgaatgcggtcaccgaggacgagcgatat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgacgcagaac
aaatggtgcgacatcctgatggcgaagcaggcgggcctcgtgaaccgtcactaccacccg
cacgaagtattcgcgtacacgatctccgggaaatggggctacctcgagcacgagtggacc
gcgacgcgcggcgacttcgtgtacgagacgccgggcgaaggccatacgctcgtcgcgttc
gatcacccggagccgatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gacgccggcaatcccgacggctatttcgacgtgcattcgtacatcgcgatgtgcaaggcc
cattacgagaaagtgggcctcggtgcgcaggcggtcgagaagctgttccgttga

DBGET integrated database retrieval system