KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4960Help
Entry
DM39_4960         CDS       T03308                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DM39_4960
Enzymes [BR:bcen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DM39_4960
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DM39_4960
    1.1.1.-  
     DM39_4960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc TrkA_N
Motif
Other DBs
NCBI-ProteinID: AIO36257
UniProt: A0A088UI49
LinkDB All DBs
Position
2:1771831..1772952
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGARDVRLVEIDTPRVGPDEVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
GRTAPLTLGHEFCGTVVETGANVTALRAGDRVAIEPEYRCRRCAYCRAGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGDTCAVFGL
GPIGLLLIMLAKLQGATTIAAVDVSPERLAAATRFGATHVFDARAFDPPALRDAIHAATG
GLGVDASFEAAGLPSTFEAAMHALRKGGRVVMVGLMPHASFDAFRAVNDELTFTASVGYR
HAYEDLLRLVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPALGPARRIH
VTGSIEHEPAVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcgcgcgcgacgtgcgcctcgtcgagatcgacacgccg
cgcgtcgggcccgacgaggtccgcatcgcggtcgcgtattgcgggatctgcggcagcgat
ctgcatgagtatgcggacggcccgcatgcgatcccggtcgacgcgccgcatccgctgtcg
ggccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtggtcgaaaccggc
gcgaacgtcaccgcgctgcgcgccggcgaccgcgtcgcgatcgagcccgagtatcgctgc
cgtcgatgcgcgtactgccgcgccgggtcgtacaacctgtgcgtgtcgatgggcttcgcc
ggactgatgggcgacggcgggatggccgacttcgcggtcgtgcccgcctacatgctgcat
cggctgcccgacggcgtcagcctcgaacaagccgcggtgatggaaccggccgccgtcgcg
ctgcatgcgctgcggcgcggcgaactgcggctcggcgacacctgcgcggtgttcgggctc
gggccgatcggcctgttgctgatcatgctcgcgaagctgcagggcgcgacgacgatcgcc
gccgtcgacgtgtcgcccgaacgtcttgcggcagccacgcgcttcggcgcgacgcacgtg
ttcgacgcccgcgcgttcgacccgcccgcgctgcgcgacgcgattcacgcggccaccggc
gggctcggcgtcgacgccagtttcgaggcggccggactgccgtccacgttcgaagcggcg
atgcacgcactgcgcaagggcggccgcgtcgtgatggtcggtttgatgccgcatgccagc
ttcgatgcattccgcgcggtcaacgacgagctgacgttcacggcaagcgtcggctaccgg
catgcatacgaggatctgctgcgcctcgtcgcgtcgggcgcgctcgacctcacgtcgatc
gtcacgcgcaccgtgtcgctcgaggacgcggtcgcggacggcttcgacgcgctgctcgcg
gatcgcgcgcagatcaagatcctggtttcccccgcgctcgggccggcccggcgcatacac
gtgacagggagcatcgagcatgagccagccgtcggtgtttga

DBGET integrated database retrieval system