KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4961Help
Entry
DM39_4961         CDS       T03308                                 

Definition
(GenBank) short chain dehydrogenase family protein
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AIO36713
UniProt: A0A088UHD0
LinkDB All DBs
Position
2:1772930..1773652
Genome map
AA seq 240 aa AA seqDB search
MSQPSVFEGKSVVVTGGTSGIGARTALRFAQAGASVVTLGLDAAGPHAPVHDAIRNVELD
VTDSDALTHTIAALPRLDVLVNGVGISRHADEYLMDQFERVLNVNLTSVMRASDAARSAL
SVNGGSIVNIASMYTYFGSKDRPAYSASKGGVAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSGLMADAQASRRILDRTPLGRWGTTDEVAEVILFLCSPGASFVTGAIVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgtcggtgtttgaaggcaagagcgtcgtcgtgacgggcggcacgtcgggc
atcggcgcgcgcaccgcgctgcgtttcgcgcaggcgggcgcgtcggtcgtcacgctcggg
ctcgacgccgccggcccgcatgcgcccgtgcacgacgccatccgcaacgtcgagctggac
gtgaccgacagcgatgcgctgacgcacacgatcgccgcgctgccgcgtctcgacgtgctc
gtcaatggcgtcggcatcagccggcacgcggacgaatacctgatggaccagttcgaacgc
gtgctgaacgtgaacctgacgtcggtgatgcgtgcatccgatgccgcacgatccgcgctg
tcggtcaacggcggctcgatcgtcaacatcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggcgtcgcgcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcatccgcgtcaacgcggtcgcgcccggctggatcgacacg
ccgctcagcagcggactgatggccgacgcgcaggcgtcgcgccggatcctcgatcgcacg
ccgctcgggcgctggggcacgaccgacgaagtcgcggaagtcatcctgttcctgtgctcg
cccggcgcatcgttcgtcaccggcgcgatcgtgccggtcgacggcggctattcgacggtc
tag

DBGET integrated database retrieval system