KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_5033
Entry
DM39_5033         CDS       T03308                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00620  Pyruvate metabolism
bcen00630  Glyoxylate and dicarboxylate metabolism
bcen01100  Metabolic pathways
bcen01110  Biosynthesis of secondary metabolites
bcen01120  Microbial metabolism in diverse environments
bcen01200  Carbon metabolism
Module
bcen_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM39_5033 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    DM39_5033 (glcB)
Enzymes [BR:bcen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DM39_5033 (glcB)
SSDB
Motif
Pfam: Malate_synthase
Other DBs
NCBI-ProteinID: AIO35303
UniProt: A0A088UDE7
LinkDB
Position
2:complement(1861005..1863179)
AA seq 724 aa
MIDQEGLQVAPALSQFIENEALPGTGIDKAAFWRGFSALVHDLAPRNRELLAERDRLQQE
LDTWHRAHPGPVRDLAAYRAFLEGIGYLVPTPSNVAAATANVDSEIATQAGPQLVVPLSN
ARYALNAANARWGSLYDALYGTDALPEDGGAERTATYNPTRGQRVIDYARNVLDNAAPLA
GASHRDALRYRVEDGQLAVETGKGVVHLAQPAQFVGYQGAAGAPSAILLKHNGLHIEIQI
DASTPIGRADLANVKDVVLEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMQGTLVEEV
AKGGKTFTRRLNADREYTTPAGGTLTLHGRSLLFVRNVGHLMTNGAVLDRDGNEIPEGIL
DGVVTTLCALHDLKAKRNSRTGSIYIVKPKMHGPAEVAFADTLFARIEDLYELPRNTLKM
GIMDEERRTSVNLAACIAAAASRVAFINTGFLDRTGDEMHTAMEAGPMIRKGDMKSSAWI
TAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAAT
LHALHYHLVDVQAVQQELEKIPYASERDALLEGLLTVPVVERAEWSDAEILSEVENNAQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKR
MARVVDQQNAGDPNYRPMAPGYDQSTAFKAACALALQGTSQPSGYTEPLLHRFRLAFKAQ
QQGA
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgatcgaccaagaaggactgcaagtcgcgcccgcgctgagccagttcatcgaaaacgaa
gcgctgccgggcaccggcatcgacaaggccgcgttctggcgcggtttctcggcgctggtg
cacgacctcgcgccgcgcaaccgcgaactgctcgccgaacgcgaccgcctgcaacaggaa
ctcgacacgtggcaccgcgcgcaccccggcccggtgcgcgacctcgccgcgtatcgcgcg
ttcctcgaaggcatcggctatctcgtgccgacgccgtcgaacgtcgcggcagccaccgcg
aacgtcgacagcgaaatcgcgacgcaggccggcccgcagctcgtcgtgccgctgtcgaac
gcgcgctatgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgacgcgctgtac
ggcaccgacgcgctgccggaagacggcggcgccgaacgcaccgcgacctacaacccgacg
cgcggccagcgcgtgatcgactatgcgcgcaacgtgctcgacaacgcggcgccgctcgcc
ggcgcatcgcaccgcgacgcgctgcgctaccgcgtagaggacggccagctcgccgtcgag
accggcaagggcgtcgtccacctcgcgcagccggcgcagttcgtcggctaccagggcgcg
gccggcgcgccgtcggcgatcctgctcaagcacaacggcctgcacatcgagatccagatc
gacgcgtcgacaccgatcggccgcgccgatctcgcgaacgtgaaggacgtcgtgctcgaa
gcggcggtcagcacgatcatcgactgcgaggactcggtcgcggccgtcgacgccgacgac
aaggtccagctctaccgcaactggctcggcctgatgcagggcacgctggtcgaggaagtc
gcgaagggcggcaagaccttcacgcgccgcctgaacgccgaccgcgaatacaccacgccc
gccggcggtacgctgacgctgcacggccgctcgctgctgttcgtgcgcaacgtcggccac
ctgatgaccaacggcgcggtgctcgaccgcgacggcaacgagattccggaagggatcctc
gacggcgtcgtcacgacgctgtgcgcgctgcacgacctgaaggcgaagcgcaactcgcgc
accggctcgatctacatcgtgaagccgaagatgcacggcccggccgaggtcgcgttcgcc
gatacgctgttcgcgcgcatcgaggatctctacgagctgccgcgcaacacgctgaagatg
ggcatcatggacgaggagcgccgcaccagcgtgaacctcgccgcgtgcatcgcggccgcg
gcctcgcgcgtcgcgttcatcaacacgggcttcctcgaccgcaccggcgacgagatgcat
accgcgatggaagcaggcccgatgatccgcaagggcgacatgaagtcgtcggcgtggatc
accgcgtacgagcgcaacaacgtgctcgcgggcctgtcggccggcctgcgcggccgcgcg
cagatcggcaagggcatgtgggcgatgccggacctgatgcacgcgatgctcgaacagaag
atcgcgcatccgcgcgccggcgcgaacaccgcgtgggtgccgtcgccgaccgccgcgacg
ctgcacgcgctgcactaccatctcgtcgacgtgcaggccgtccagcaggaactcgagaag
attccgtatgcgagcgagcgcgacgcgctgctcgaaggcctgctgaccgtgccggtcgtc
gagcgcgccgaatggagcgacgccgagatcctgagcgaagtcgagaacaacgcgcagggc
atcctcggctacgtcgtacgctgggtcgaacagggcgtcggctgctcgaaggtgcccgac
atccacgacgtcggcctgatggaagaccgcgcgacgctgcgcatctcgagccagcacatc
gcgaactggctgcgtcacggcgtgatcaccgaggcgttcgtgctcgacgtgttcaagcgg
atggcgcgcgtcgtcgaccagcagaacgcgggcgacccgaactatcgcccgatggcgccc
ggctacgaccagtcgaccgcgttcaaggctgcgtgcgcgctcgcactgcagggcacgtcg
cagccgagcggctataccgagccgctgctgcaccgcttccggctcgcgttcaaggcgcag
cagcagggcgcgtaa

DBGET integrated database retrieval system