KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_5034
Entry
DM39_5034         CDS       T03308                                 

Definition
(GenBank) hypothetical protein
  KO
K11477  glc operon protein GlcG
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    DM39_5034
SSDB
Motif
Pfam: Haem_degrading GAF_2 PocR
Other DBs
NCBI-ProteinID: AIO37095
UniProt: A0A088UI35
LinkDB
Position
2:complement(1863217..1863621)
AA seq 134 aa
MQTKPELEFADADRMLAAARAEAERHGWCVSIAIVDDGGHLLAFARLDGASPASASIAQD
KARAAALGRRETKAYEDMINNGRTAFLSAPLTGLLEGGVPVTVGGRIAGAIGVSGVKSEQ
DAQIARAGTQSVAA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcagacgaaacccgaactcgaattcgccgacgccgaccgcatgctcgccgccgcccgc
gcggaagccgagcgccacggctggtgcgtgtcgatcgcgatcgtcgacgacggcggccac
ctgctcgcgttcgcacgcctcgacggcgcgtcgcccgcgagcgcgagcatcgcgcaggac
aaggcgcgcgcggcggcgctcggccgccgcgaaacgaaagcctatgaggatatgatcaac
aacggccgcaccgcgtttctcagcgcgccgctgacgggcttgctcgaaggcggcgtgccg
gtcacggtcggcggccggattgcgggcgcaatcggcgtgtctggcgtaaagtccgaacag
gatgcgcagatcgcccgcgccggcacacaaagcgtcgcggcctga

DBGET integrated database retrieval system