KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_5448Help
Entry
DM39_5448         CDS       T03308                                 

Definition
(GenBank) xylose isomerase-like TIM barrel family protein
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM39_5448
Enzymes [BR:bcen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     DM39_5448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIO34650
UniProt: A0A088UB03
LinkDB All DBs
Position
2:complement(2322700..2323476)
Genome map
AA seq 258 aa AA seqDB search
MPRFAANLSMMYNEHAFLERFAAAAHDGFKAVEYLFPYDFSADDIRARLDAHGLEQALFN
APPGDWAAGERGIASLPGREDEFRRGIDQALDYARVLGNKKLHVMAGLVAPGADRARHRD
TYVANLRHAAQAAAAHGITVLIEPINQRDMPGYFVSRQDDAHALCADIGAQNVKVQFDCY
HCQIVEGDLAMKLRRDFAGIGHIQIAGVPERHEPDLGELNYPYLFELIDALGYDGWIGCE
YRPKAGTSEGLGWLRAYL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcttcgccgccaacctctcgatgatgtacaacgagcatgcgtttctcgaacgc
ttcgccgctgccgcccacgacggcttcaaggccgtcgagtacctgttcccgtacgacttc
tccgccgacgacatccgcgcacgcctcgacgcgcacggcctcgaacaggcgctgttcaac
gcgccgcccggcgactgggccgccggcgaacgcggcatcgcgtcgctgccaggccgcgag
gacgagttccggcgcggcatcgaccaggcgctcgactatgcgcgcgtgctcggcaacaag
aagctgcacgtgatggccggcctggtcgcgccgggcgccgaccgcgcgcgccatcgcgac
acctatgtcgcgaacctgcgccacgcggcgcaggccgccgccgcgcacggcatcacggtc
ctgatcgagccgatcaaccagcgcgacatgcccggctatttcgtgagccggcaggacgat
gcgcacgcgctctgcgcggacatcggcgcgcagaacgtgaaggtgcagttcgactgctat
cactgccagatcgtcgaaggcgatctcgcgatgaagctcaggcgcgacttcgccggcatc
ggccatatccagatcgcgggcgtgcccgagcgtcacgagccggacctcggcgaactcaac
tacccgtatctgttcgagctgatcgacgcgctcggctacgacggctggatcggctgcgag
taccgcccgaaggccggcacgtcggaaggactcggctggctgcgcgcctacctgtaa

DBGET integrated database retrieval system