KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_6423Help
Entry
DM39_6423         CDS       T03308                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIO30400
UniProt: A0A088TYN4
LinkDB All DBs
Position
3:216542..218014
Genome map
AA seq 490 aa AA seqDB search
MNRPSLNMPHADRLYIGGRWVAPASTDTCAVLNCATEDVVAHAAMANEADVDAAVRAARE
AFDRGPWPHLSPAERGAFLEKIAARLEALNDDFARGWSIESGVLYRIAKPRIGLFLSGAF
RQYAAMARNYPFVAPARAVTGHQAYRVQEPVGVVAVIVPWNGPAGLLAYKIAPALLAGCT
VVIKNSPETPSSGHLFAQICDEVGLPPGVINMLTADRTVSESLVRHPGVDKITFTGSTGA
GRRIGAVAAERVARITLELGGKSPAVVLDDYDVEMAAKVLGAPYFSYLSGQVCHSLTRII
VPRAKHDRMVDALVEAARGMVLGDPLDDATSMGPLATAAQRDAVERLVAQGVSDGARLAI
GGKRPARLARGFFFEPTVFANVDNRSRIAQNEFFGPVLSVIPADSEQHAIEMANDTIFGL
NAAVFTHDTERALQVARRLRAGSVGHNASRTDFSIGFGGFKQSGIGREGGTGGLEAFLES
KTVVLDQPAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcccttccctgaacatgccgcacgcggatcgcctctatatcggcggccgctgg
gtggcgcctgcttccaccgacacctgcgcggtgctcaactgcgcgaccgaggacgtggtc
gcgcacgcggcgatggccaacgaagccgacgtcgacgctgccgtgcgcgccgcgcgcgag
gcgttcgatcgcgggccgtggccgcatctgtcgccggccgaacgcggcgctttcctcgag
aaaatcgccgcccgcctcgaagcgttgaacgacgatttcgcgcgcggctggagcatcgag
tccggcgtgctgtaccggatcgccaagccgcgcatcggcctgtttctcagcggcgcgttc
cggcagtacgcggcaatggctcgcaactatccgttcgtcgcgcccgcgcgcgccgtgacc
ggccatcaggcctaccgcgtgcaggagccggtcggcgtggtggcggtgatcgtgccgtgg
aacgggccggcagggctgctcgcctacaagatcgcaccggccctgctcgcgggctgcacg
gtcgtcatcaagaattcgcccgagacgccgagttcgggtcatctgttcgcgcagatctgc
gacgaggtcggcctgccgcccggcgtgatcaacatgctgacggccgaccggaccgtgtcc
gaatcgctcgtgcgccatcccggcgtggacaagatcaccttcacgggctccaccggcgct
ggccggcgcatcggcgcggtggcggccgaacgcgtcgcgcgcatcacgctcgagctcggc
ggcaaatcgcctgccgtggtactcgacgactacgacgtcgaaatggccgccaaggtgctc
ggcgcaccgtatttcagctatctgtcgggccaggtctgtcacagcctcacgcgcatcatc
gtgccgcgcgcgaagcacgaccggatggtcgatgcgctcgtcgaggccgcacgcggcatg
gtgctcggcgacccgctcgacgacgcgacgagcatgggtccgctcgcgacggccgcgcag
cgcgacgcggtcgagcgactggtcgcgcaaggcgtgtccgacggcgcgcgtctcgcgatc
ggcggcaagcggcccgcccgtctggcgcgcggcttcttcttcgaaccgacggtgttcgcg
aacgtcgacaaccgctcgcgcatcgcgcagaacgagttcttcggcccggtgctgtccgtc
atcccggccgacagcgagcaacacgcgatcgagatggccaacgacacgatcttcggcctg
aacgccgcggtgttcacgcacgacaccgagcgggcgctgcaggtcgcgcgccgcttgcgc
gcgggctcggtcggccacaacgcgtcgcgcaccgatttctcgatcggcttcggcggcttc
aagcaatcgggcatcgggcgcgaaggcggcacgggcggcctcgaagcgttcctcgaatcc
aagaccgtggtcctggaccagccggccgcctga

DBGET integrated database retrieval system