KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_7062Help
Entry
DM39_7062         CDS       T03308                                 

Gene name
treS
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00500  Starch and sucrose metabolism
bcen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DM39_7062 (treS)
Enzymes [BR:bcen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DM39_7062 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DM39_7062 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AIO30809
UniProt: A0A088UMN6
LinkDB All DBs
Position
3:complement(992420..995830)
Genome map
AA seq 1136 aa AA seqDB search
MKREDSLDDVRRAQFASLAPAGTPRQRRVRRRAPALCADDPLWYKDAIIYQVHVKSFFDS
NHDGIGDFPGLIAKLDYIAELGVDAIWLLPFYPSPRRDDGYDISDYRDVHPDYGTLADVR
RFIREAHARGIRVITELVINHTSDQHPWFQRARRARPGSMYRNYYVWSDTDTKYAGTRII
FLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVLQVMRFWLDLGIDGLRLDA
VPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDECH
MAFHFPLMPRIYMSIASEDRFPIIDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSERD
LLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDEIGMGDN
IHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLLN
WTRRILATRRATQAFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELDL
SEFAGRVPIEMTSDSPFPPVGQLPYLLTFPPYGFLWFVLSSHGREPAWRQPHAEPLPEYV
TLVMRRGDTRPDVAQLHTLAHDALASWLVRRRWFASKDRTIGEARLNVVTPMPGEPFQYA
EAWVTVRGDSGVERYVVPLAAAWGGETSGPLFAQLALARVRRGHTVGYLTDAFALPAFAH
GMLRKLRAAETVPTSDGGQLAFLPDAGLAELDPGDDAEVRWLAAEQSNSSLVIGDAIVLK
LVRKVAHGVHPEAEMSRYLTRIGYRNTATLAGEVVHVDPDGAPHTVAILQRYVDNQGDAW
TRSFDFLKRAVDELALPAADDEEAAEPDLEPEAMHGYAAFAGIVGTRLGELHVALAQPSD
DPAFAPERATPAHVEGWCADAIASFEHALDVLGTRLDALDASSRAAADALLASRRDAVRA
LGKLVPRTLDAQCIRIHGDFHLGQVLDVQGDALLIDFEGEPARPLERRRAKSHPLRDVAG
FLRSLSYVSATGQFTIEKAPPQAADRKRALFDRFGQAAADRFVECYRAAAEQAPVRFVDP
RYTDRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVERLLDHGAADDGESR
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaagattccctcgacgacgtgcgccgcgcgcagttcgcgtcgctcgcaccg
gccggcacgccgcgccagcgccgcgtgcgccgccgcgcgccggccctgtgcgcggacgac
ccgctctggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttcttcgattcg
aaccacgacggcatcggcgatttcccgggcctgatcgcgaagctcgactacatcgcggaa
ctcggcgtcgacgcgatctggctgctgccgttctacccgtcgccgcgccgcgacgacggc
tacgacatctccgactatcgcgacgtgcatcccgactacggcacgctcgccgacgtgcgc
cgcttcatccgcgaagcgcatgcgcgcggcatccgcgtcatcaccgagctggtgatcaac
cacacgtcggaccagcatccgtggttccagcgcgcgcgccgcgcgagacccggctcgatg
taccgcaactactacgtgtggtccgacaccgacacgaagtacgcgggcacgcggatcatc
ttcctcgataccgaaacgtcgaactggacccacgacccggtcgcgggccagtactactgg
catcgcttctactcgcaccagccggacctgaacttcgacaacccggccgtcgtgcgcgag
gtgctgcaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgacgcg
gtgccgtacctcgtcgagcgcgaaggcaccaacaacgagaacctgcccgagacgcacgcg
atcctgaagcggatccgcgcgacgatcgacgccgagtatccgaaccgcatgctgctcgcc
gaagcgaaccagtggccggaggacgtgcaggaatatttcggcaacgaggacgaatgccac
atggcgttccactttccgctgatgccgcgcatctacatgtcgattgccagcgaggaccgc
tttccgatcatcgacatcatgcggcagacgccggcgctcgcgccgagcaaccagtgggcg
gtgttcctgcgcaatcacgacgagctgacgctcgagatggtcaccgattccgaacgcgac
ctgctgtggcagacctatgcgagcgaccgccgcgcgcggctgaacctcggcatccggcgc
cggctcgcaccgctgatggagcgcgaccgccgccgcatcgagctgatcaactcgctgctg
ctgtcgatgccgggcacgccggtgatctattacggcgacgagatcgggatgggcgacaac
atccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtccgaccgcaac
ggcgggttctcgcgcgccgatccggaactgctggtgctgccgcccgtgatgggctcgctg
tacggctatgacgcgatcaacgtcgaggcgcagacgcgcgacccgcattcgctgctgaac
tggacgcgccgcatcctcgcgacgcgccgggcaacgcaggcgttcggccgcggcacgatc
cgcttcctgcggcccgagaaccgcaaggtgctcgcgtatctgcgcgagctggacggccac
gagccggtgctgtgcgtcgcgaacctgtcgcgcgcatcgcaggcggtcgagctggacctg
tccgaattcgcgggccgcgtgccgatcgagatgacgtccgactcgccgtttccgccggtc
ggccagctcccgtatctgctcacctttccgccgtacgggttcctgtggttcgtgctgtcg
tcgcacgggcgcgaaccggcgtggcggcagccgcatgcggagccgctgcccgaatacgtg
acgctcgtgatgcggcgcggcgacacgcggcccgacgtcgcgcagctgcacacgctcgcg
cacgatgcgctcgcgtcgtggctggtgcgccggcgctggttcgcgtcgaaggaccgcacc
atcggcgaggcgcggctcaacgtggtcacgccgatgccgggcgagccgttccagtacgcg
gaagcgtgggtcacggtgcgcggcgacagcggcgtcgagcgctacgtggtgccgctcgcg
gccgcatggggcggcgaaacttccggcccgctgttcgcgcagctcgcgctcgcgcgcgtg
cggcgcggccatacggtcggctacctgaccgacgcattcgcgctgccggcgttcgcgcac
gggatgctgcgcaagctgcgcgcggccgagacggtgccgacctcggacggcggccagctc
gccttcctgcccgacgcggggctggccgagctcgacccgggcgacgacgcggaagtgcgc
tggctcgcggccgagcagagcaacagctcgctcgtgatcggcgatgcgatcgtgctgaag
ctggtgcgcaaggtcgcgcacggcgtgcatccggaagcggagatgagccggtatctgacg
cgaatcggctaccggaacaccgccacgctcgccggcgaggtcgtgcacgtcgatcccgac
ggcgcgccgcacaccgtcgcgatcctgcagcgctacgtcgacaaccagggcgacgcatgg
acgcgttcgttcgacttcctgaagcgcgcggtcgacgaactggcgctgccggccgccgac
gacgaggaagccgccgagccggacctcgaaccggaagccatgcacggctatgcggcgttc
gccggcatcgtcggcacgcggctcggcgagctgcacgtcgcgctcgcgcagccgtccgac
gatcctgcgttcgcgccggagcgcgcgacgcccgcgcatgtcgaaggctggtgcgccgac
gcgatcgcatcgttcgagcacgcgctcgacgtgctcggcacacggctcgatgcgctcgac
gcgagctcgcgcgcggcagccgacgcgctgctggcctcacgccgcgacgcggtgcgcgcg
ctcggcaagctcgtgccgcgcacgctcgacgcgcagtgcatccgcatccacggcgacttc
catctcggccaggtgctcgacgtgcagggcgatgcgctgctgatcgatttcgaaggcgag
ccggcacgcccgctcgagcggcggcgcgcgaaatcgcatccgctgcgcgacgtcgccggg
ttcctgcgctcgctgtcgtatgtcagcgcgaccgggcagttcacgatcgagaaggcgccg
ccgcaggccgccgaccgcaagcgcgcgctgttcgaccgcttcgggcaggcggcggccgac
cggttcgtcgaatgctatcgcgcggccgccgagcaggcgccggtgcgcttcgtcgatccg
cgctacaccgatcgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctgtgc
tacgaggccgcgaaccgccccgactggctgagcgtgccggtgggcggcctcgcggcgctg
gtcgagcggctgctcgaccacggcgccgccgacgacggagaatcgcgatga

DBGET integrated database retrieval system