KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_858Help
Entry
DM39_858          CDS       T03308                                 

Definition
(GenBank) amidase family protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
bcen00970  Aminoacyl-tRNA biosynthesis
bcen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcen00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DM39_858
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcen03029]
    DM39_858
Enzymes [BR:bcen01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DM39_858
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DM39_858
Mitochondrial biogenesis [BR:bcen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DM39_858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AIO31412
UniProt: A0A088U4M9
LinkDB All DBs
Position
1:complement(923074..924450)
Genome map
AA seq 458 aa AA seqDB search
MTTFTPFPPLAQLAADLAAGTTTSRALVDAALERIADPSGQGAVVFTEVDADNARAAADA
HDRLRAAGTVLSPLAGIPVSVKDLFDVAGQVTRAGSRVLDGAPPAQADAVAVARLKRAGA
VLVGRTNMSEFAFSGLGLNPHFGTPASPYRRGVPGDARIAGGSSSGAAASVADGMAAVAL
GTDTGGSIRIPAALCGLTGFKPTASRIPTQGGVPLSTTLDSFGPIGLTVACCALVDRMLA
GLEPHVPAARPLEGVRLGVLTNHVTDGVDADVAAALDTALKHLEAAGAIVTEVRFAALDR
LPDINRFGFSPIEAYAWHRPLLAQHRDRYDPRVLTRILKGEPASAADYLDLLAARRAMLD
EAAHTVWSRFDALVAPTVPVVPPRIADLEADDAAFTRTNALILRNPSAFNFLDACALSLP
CHPRDAAPVGLMLAAAPHRDDALLAIGQSVEAVLNTIR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttcaccccgttccccccgctcgcccagctcgccgccgatctcgccgccggc
acgaccaccagccgcgcgctcgtcgacgccgcgctcgagcgcatcgccgatccgtccggc
cagggcgccgtcgtgttcaccgaggtcgacgccgacaacgcgcgcgctgcggccgacgcg
cacgaccgcctgcgcgccgccggcaccgtgctgtcgccgctcgcgggcatcccggtgtcg
gtcaaggacctgttcgacgtcgccggccaggtcacgcgcgcgggttcgcgcgtgctcgac
ggcgcgccgcccgcgcaggccgacgcggtcgccgtcgcgcggctcaagcgcgcgggcgcg
gtgctggtcggtcgcaccaacatgagcgaattcgcgttctcgggcctcgggctgaatccg
cacttcggcacgccggcgtcgccgtaccggcgcggcgtgccgggcgatgcgcgaattgcc
ggcggctcgtcgtcgggcgcggcggcttccgtcgcggacgggatggcggccgtggcgctc
ggcaccgacaccggcggctcgatccgcattcccgccgcgctgtgcggactgaccggcttc
aagccgaccgcgagccggatcccgacgcaaggcggcgtgccgctgtcgaccacgctcgat
tcgttcggcccgatcggcctgacggtcgcgtgctgcgcgctggtcgaccggatgctcgca
ggcctcgagccgcacgtgccggccgcacggccgctcgaaggcgtgcggctcggcgtgctg
acgaaccatgtgacggacggcgtcgatgccgacgtcgcggccgcgctcgataccgcgctc
aagcatctggaagccgccggcgcgatcgtcaccgaagtgcgcttcgccgcgctcgaccgg
ctgccggacatcaaccgcttcggcttctcgccgatcgaggcctacgcgtggcatcgcccg
ctgctcgcgcagcatcgcgaccgctacgacccgcgcgtgctgacgcgcatcctgaagggc
gagcccgcgagcgcagccgactatctggacctgctcgccgcgcgccgcgcgatgctcgac
gaagccgctcacacggtctggtcgcgcttcgatgcgctcgtcgcgccgacggtgccggtc
gtgccgccgcgcatcgcggacctcgaagcggacgacgccgcgttcacgcgcaccaacgcg
ctgatcctgcgcaatccgagcgcgttcaacttcctcgacgcatgcgcgctgtctctgccg
tgccatccgcgcgacgcggcgccggtcggcctgatgctggcggccgcgccgcatcgcgac
gatgcgctgctcgcgatcggccagtcggtcgaggccgtgctgaacacgatccgctga

DBGET integrated database retrieval system