KEGG   Burkholderia cenocepacia H111: I35_1414Help
Entry
I35_1414          CDS       T03804                                 

Gene name
sucB
Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00020  Citrate cycle (TCA cycle)
bceo00310  Lysine degradation
bceo00380  Tryptophan metabolism
bceo01100  Metabolic pathways
bceo01110  Biosynthesis of secondary metabolites
bceo01120  Microbial metabolism in diverse environments
bceo01130  Biosynthesis of antibiotics
bceo01200  Carbon metabolism
Module
bceo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bceo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I35_1414 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    I35_1414 (sucB)
   00380 Tryptophan metabolism
    I35_1414 (sucB)
Enzymes [BR:bceo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     I35_1414 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CDN59937
LinkDB All DBs
Position
1:1534433..1535653
Genome map
AA seq 406 aa AA seqDB search
MLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQVLQNDGDTVVADQIIATIDT
EAKAGAAEAAAGAAEVKPAAAPAAAAPAAQPAAATASSSAAASPAAAKLLAEKGLSTGDV
AGSGRDGRVTKGDALAAGSAPKAAPAAAPAKTAAAKPSLPEVKVPASAATWLNDRPEQRV
PMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMELRNKYKDKFEKEHGVKLGFMSFFV
KAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILRNADQLSLAEIEKKI
AEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAILGVHATKERPVVEN
GQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagtggaagaagaagccgggcgaagcagtcgcgcaggatgaaatcctgatcgaa
ctcgagaccgacaaggtcgtcctcgaagtgccggcaccggcagcgggcgtgctcgcgcaa
gtgctgcagaacgacggcgacacggtcgtggccgaccagatcatcgcgacgatcgacacc
gaagcgaaggcaggtgctgccgaagcagcggcaggcgcagccgaagtcaagccggcagcc
gcgccggctgccgccgcaccggccgctcagccggcagccgcaaccgcgtcgagctcggcc
gccgcatcgccggccgcagcgaagctgctggccgagaagggcctgtcgacgggcgacgtc
gcaggttcgggccgcgacggccgcgtcacgaagggcgacgcgctggctgcaggcagcgca
ccgaaggctgctccggccgccgcaccggcgaagaccgccgctgcgaagccgtcgctgccg
gaagtgaaggtgccggcgtcggccgcgacgtggctgaacgatcgtccggaacagcgcgtg
ccgatgtcgcgtctgcgtgcgcgtatcgccgagcgtctgctcgaatcgcagcagaccaac
gcgatcctgacgacgttcaacgaagtgaacatggctccggtcatggaactgcgcaacaag
tacaaggacaagttcgagaaggaacatggcgtgaagctcggcttcatgtcgttcttcgtg
aaggccgccgtccatgcgctgaagaaattcccgctcgtgaacgcgtcgatcgacggtaac
gacatcgtctatcacggctacttcgacatcggtatcgcggtcggttcgccgcgcggcctg
gtcgtgccgatcctgcgcaacgcggatcaactgagcctcgccgagatcgagaagaagatc
gccgaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggt
acgttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgaccccgatcatcaac
ccgccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaac
ggccagatcgtgatccgcccgatcaactacctcgcgctgtcgtacgaccaccgcatcatc
gacggccgcgaagccgtgctgtcgctcgtcgcgatgaaggatgcgctggaagatccggca
cgcctgctgctcgacctgtaa

DBGET integrated database retrieval system