KEGG   Burkholderia cenocepacia H111: I35_1748Help
Entry
I35_1748          CDS       T03804                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007 DUF5061
Motif
Other DBs
NCBI-ProteinID: CDN60271
LinkDB All DBs
Position
1:complement(1899267..1900703)
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDAQDAIRAARAAFDAWAA
TPAATRAGYLRKIVEHLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEARVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFATAVKGTVNACYLNAGQTCSAHTRMLVPEARYDEAREIAK
AVAETYVAGDPRQEATRLGALASAVQQQRVQAYIQRGIDEGAELVTGGTGLPEGLAKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
RVARRIRTGQVDINGGTWNGAAPFGGFKQSGHGRENGVYGLEEYLEYKSMQLKPAKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctacatcgacggcgcatggcgcaaaccggccggcaccggc
acgatcgacgtgatcgactcgggcaccgaagccgtgatcggccggattcccgagggcgtc
gcgtccgacgcacaggacgcgatccgcgcggcgcgcgcggccttcgacgcgtgggcggcc
acgccggccgcgacgcgcgcgggctatctgcgcaagatcgtcgagcatctgcaggcgcgc
agcgaggaactcgcgcagtcgatcaccggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtgggcggcccgatctacaactggaaggcgtacgcgaagctcgccgaatcg
ttcgaattcgaggcccgggtcggcaattcgctggtggtgcgcgagccggtcggcgtcgtc
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgcgccggcg
ctcgcggccggctgcacggtggtgctgaagccgtccgaagtcgcgccgctcaacgcgttc
atgctcgccgaagcgatccacgaggccgggctgccggccggcgtgttcaacctcgtgtgc
gggtatggcccggtcgtcggcgaggtgttggcgaccgacccggacgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtggccgaactggcggccgcgggcgtcaag
cgcgtcgcgctggagctcggcggcaagtcggcatcggtgatcctcgacgacgccgatttc
gcgacggcggtgaagggcaccgtcaacgcgtgctacctgaacgccggccagacctgctcc
gcgcatacgcggatgctggtgccggaagcccgctacgacgaagcgcgcgagatcgcgaag
gccgtggccgaaacgtacgtcgcgggcgacccgcggcaggaggcgacgcgcctcggcgcg
ctggcgtcggccgtgcagcagcagcgcgtgcaggcgtacatccagcgcgggatcgacgaa
ggcgcggaactcgtgacgggcggcaccgggttgccggaagggctcgcgaagggcttcttc
gtgaagccgaccgtgttcggccgcgtcgatccgaaatcgacgatcgcgcaggaagagatc
ttcgggccggtgctgtcgatcatcacgtatcgcgatgaagacgaagccgtgcggatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggccggcagcgacgaacgcgcgatg
cgcgttgcgcgccgcatccgcaccgggcaggtcgacatcaacggcggcacgtggaacggc
gccgcgccgttcggcggcttcaagcagtccgggcacggccgcgagaacggcgtgtacggg
ctcgaagagtatctcgaatacaagtcgatgcagttgaagccggccaagccggcctga

DBGET integrated database retrieval system