KEGG   Burkholderia cenocepacia H111: I35_2245Help
Entry
I35_2245          CDS       T03804                                 

Definition
(GenBank) Glutathione S-transferase N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    I35_2245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bceo02000]
    I35_2245
Enzymes [BR:bceo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I35_2245
Transporters [BR:bceo02000]
 Other Transporters
  Pores ion channels [TC:1]
   I35_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: CDN60768
LinkDB All DBs
Position
1:complement(2446594..2447250)
Genome map
AA seq 218 aa AA seqDB search
MLQLCGIPLSNYYNKVKFVLLEHDIPFEESVCGLPISDPAQLADSPLGKIPFLKTEEGAL
FESQVIVEYLAARYPEKGILPASPFAAAKVRELVETLELYLEWMAREVYTEAFFGGKVSD
GMKAHVEKRLPRAIDAFKQMTRFSPYVLGESFGLADIAAWVHLPVIGMATKAIFGRDFLL
DAGIDWKAHAKTVGERPAAQRVAAERKAYIEAANVVRS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctacagctgtgcggtatcccgttgtccaactactacaacaaggtgaagttcgtcctg
ctcgagcacgacattccgttcgaggagtcggtgtgcggtttgccgatcagcgatccggcg
cagcttgccgattcgccgctcggcaagattccgttcctgaagaccgaagagggcgcgctg
ttcgagtcgcaggtgatcgtcgaatacctggcggcgcgctatcccgaaaaaggtattttg
cccgcaagcccgttcgcggccgcgaaggtgcgcgaactggtcgagacgctcgagctgtat
ctcgaatggatggcgcgcgaggtctatacggaagcgtttttcggcggcaaggtcagcgac
gggatgaaggcgcacgtcgagaagcgtctgccgcgcgcgatcgatgccttcaagcagatg
acgcggttttcgccgtatgtgctcggcgaatcgttcggcctcgcggacattgcggcgtgg
gtccatctgccggtcatcggcatggcgacgaaggccatattcggccgcgacttcctgctc
gatgcaggcatcgactggaaggcgcacgcgaagacggtgggtgagcgcccggccgcgcaa
cgcgtggcagccgagcgcaaggcgtatatcgaagcggcgaacgtcgtgcgttcgtaa

DBGET integrated database retrieval system