KEGG   Burkholderia cenocepacia H111: I35_2742Help
Entry
I35_2742          CDS       T03804                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00564  Glycerophospholipid metabolism
bceo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    I35_2742 (glpD)
Enzymes [BR:bceo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     I35_2742 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 3HCDH_N NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CDN61265
LinkDB All DBs
Position
1:2963477..2965000
Genome map
AA seq 507 aa AA seqDB search
MTQPNRYDLLVVGGGINGAGIARDAAGRGLSVMLCEQDDLASHTSSSSTKLIHGGLRYLE
YNEFGLVRKALQERETLLRAAPHIMWPLRFVMPHMPNLRPAWLIRIGLFLYDHLAKRELL
PGSRGIDMRRHAAGAPLIDSIKRGFVYSDGWVDDARLVVLNAMDAKERGAEILTRTKLLS
AERRGDEWEARLQQADGSIRVVQARAIANAAGPWVGDVLHGALGRGAHHSVRLVKGSHII
TRRLFDHDHAYIFQNPDKRIIFAIPYEHDFTLIGTTDVEYTSDPAKVAIDRDETQYLCDS
INRYFKRKISPADVHWTYSGVRPLLEDENAANASAVTRDYRLELDDGAGAPLLSVFGGKI
TTFRKLAEEAGDMLCRALGRDAKTWTAGVALPGGDIADAKFDGFASAFAKRHPWLPAALA
RRYARAYGTRAERVVADAKSLADLGAEIAPGIHDAELRYLRDAEWATCAQDVLWRRSKLG
LHVAPGTLDAVTAAVDAWFAAAHAPHA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaaccgaatcgctacgatctgctcgtcgtcggcggcggcatcaacggcgcgggg
atcgcgcgcgatgcggccggccgcggcctgtcggtcatgctctgcgagcaggacgacctc
gcgtcgcatacgtcgtcgtccagcacgaagctgattcacggcggcctgcgttacctcgag
tacaacgagttcggactggtgcgcaaggcgctgcaggagcgcgaaacgctgctgcgcgcg
gcgccgcacatcatgtggccgctgcgcttcgtgatgccgcacatgccgaacctgcgcccg
gcctggctgatccgcatcggcctgttcctctacgatcacctcgcgaaacgcgagctgctg
cccggctcgcgcggcatcgacatgcgccgccatgcggccggcgcgccgctgatcgactcc
atcaagcgcggcttcgtgtattccgacggctgggtcgacgacgcccgcctcgtcgtgctg
aacgcgatggacgcgaaggagcgcggcgccgagatcctgacgcgcacgaagctcctgtcc
gccgaacgccgcggcgacgaatgggaagcgcggctgcagcaggccgacggttcgatccgc
gtcgtgcaggcgcgcgcgatcgcaaacgcggccggcccgtgggtcggcgacgtgctgcac
ggcgcgctcggccgcggcgcgcatcacagcgtgcggctcgtgaagggcagccacatcatc
acgcgccgcctgttcgatcacgatcacgcgtacatcttccagaacccggacaagcggatc
atcttcgctattccgtacgagcacgacttcacgctgatcggcacgaccgacgtcgaatac
acgagcgatccggcgaaggtcgcgatcgatcgcgacgagacgcagtacctgtgcgattcg
atcaaccgctatttcaagcgcaagatctcgccggcagacgtgcactggacctattcgggc
gtgcgcccgctgctggaagacgagaacgcggcgaacgcatcggccgtcacgcgcgactat
cgccttgaactcgacgacggcgcgggcgcgccgctgctgtcggtgttcggcggcaagatc
acgacgttccgcaagctcgcggaagaagccggcgacatgctgtgccgcgcgctcggccgc
gacgcgaagacctggacggccggcgtcgcgctgccgggcggcgacatcgcggacgcgaag
ttcgacgggttcgccagcgcgttcgcgaaacgccatccgtggctgcccgccgcgctcgcg
cgccgctatgcacgggcgtacggcacgcgtgcggagcgcgtggtggcggacgcgaagtcg
ctcgccgatctcggcgccgaaatcgcgccgggcatccacgatgccgaactgcgctacctg
cgcgacgccgaatgggcgacctgcgcgcaggacgtgctgtggcgccgctcgaagctcggg
ctgcacgtcgcgcccggcacgctcgacgccgtgaccgccgcggtcgacgcatggttcgcc
gccgcgcatgcgccgcacgcctga

DBGET integrated database retrieval system