KEGG   Burkholderia cenocepacia H111: I35_4034Help
Entry
I35_4034          CDS       T03804                                 

Gene name
kduD
Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR Glyco_transf_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: CDN61870
LinkDB All DBs
Position
2:complement(37566..38288)
Genome map
AA seq 240 aa AA seqDB search
MNRQWAFDGQTVVVTGGTSGIGARTALRFAQAGASVVALGLDAAGPHAPVHDRIRCVELD
VADGAALTRTIAGLPRLGALVNGVGISRHADEYRMDQFEHVLNVNLTSVMRASDAALPAL
AATGGSIVNIASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADHGIRVNAVAPGWIDT
PLSSALMADTQASRRIVERTPLGRWGTTDEVAEVILFLCSPGASFVTGSVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtcagtgggcgtttgacgggcagaccgtcgtggtgacgggcggcacgtcgggc
atcggcgcgcgcaccgcgctgcggttcgcgcaggccggcgcgtcggtcgtcgcgctcggg
ctcgacgccgccggtccgcacgcgccggtgcatgaccgcatccggtgcgtggaactcgac
gtggccgacggcgcggcactgacgcgcacgatcgccgggctgccgcggctcggcgcgctc
gtcaacggcgtcggcatcagccgccacgcggacgaataccggatggaccagttcgagcac
gtgctgaacgtgaacctgacgtcggtgatgcgggcctccgacgccgcgctgcccgcgctg
gcggccaccggcggcagcatcgtcaatatcgcgtcgatgtacacgtacttcggcagcaag
gaccggcccgcgtacagcgcgagcaagggcggcatcgcgcagctcacgcgttcgctcgcg
caggcgtgggccgatcacggcatccgtgtgaacgcggtcgcgccgggctggatcgacacg
ccgctcagcagcgcgctgatggccgacacgcaggcgtcgcgccgcatcgtcgagcgcacg
ccgctcgggcgctggggcacgaccgacgaagtcgcggaagtgatcctgttcctgtgctcg
cccggcgcgtcgttcgtcaccggctcggtcgtgccggtggacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system