KEGG   Burkholderia cenocepacia H111: I35_4036Help
Entry
I35_4036          CDS       T03804                                 

Definition
(GenBank) Major facilitator family transporter
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: CDN61872
LinkDB All DBs
Position
2:complement(39389..40693)
Genome map
AA seq 434 aa AA seqDB search
MTSPSSSRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNTQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVLGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAYGWREAFYVSC
IPGFLIAFCIWRWVREVPPGGVRHAQADTTAAPAAGGATVSRWALLKERNILLCVLISCF
FLTWFVVIISFAPVFLVESRHLSPADMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIA
FALIAAVCPVVLIHVGSVWALGALVFVTYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSTTGAILACVLSFGLVETAPAVLRKRALAG
AAAGRLDTQNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccgtcctcctcccggcccgcctggacgtacgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgtttccg
ttcatgtcggccgagctgcacctgacgaacacgcagctcggcatggtgtcgtccgcgctc
gcactcacatgggcgctgtcgggcgccgccacgggtgcatggtccgacgcgcgcggcacc
cgcaagccgctgctgatcgcggccgtgctcggcttttccgtgtgctcggcgctgtcgggc
ctcgtcggcggcttcgcgagcctgatcgcgtttcgcgcgctgatgggcatcgccgaaggg
ccggtgctgccgctgtcgcaatcgctgatggtcgaaagttcgacgccgagccgccgcggg
ctgaacatgggcctgctgcagggctcggccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgccaccgcgtacggctggcgcgaggcgttctacgtgtcgtgc
attccgggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaagtgccgcccggc
ggcgtgcgccacgcgcaggccgacaccaccgcggcaccggccgccggcggtgcgacggtc
agccgctgggcgctgctgaaggagcgcaacatcctgctctgcgtgctgatcagctgcttc
ttcctcacgtggttcgtcgtgatcatctcgttcgcgccggtattcctcgtggaaagccgc
cacctgtcgccggccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggcttcgcggtgccggcgatctccgaccggatcggccgcaagccgacgatgatcgcg
ttcgcgctgatcgcggccgtgtgcccggtcgtgctgatccacgtcggctccgtctgggcg
ctcggcgcgctggtgttcgtcacgtacacgggcctcggctgcttcacgctgttcatggcg
acgatcccggccgagacggtgccgccgcgcgcgatcgcgagcgcgctcgggctgatcatg
ggcgccggcgagctgatcggcggcttcgtcgcaccgaccgtcgccggcttcgccgcggac
aagtacggcctgcagttcgcgatgtggacgtcgaccaccggcgcgatcctcgcgtgcgtg
ctgtcgttcggcctcgtcgaaaccgcgccggccgtgctgcgcaagcgcgcgctcgccggc
gccgcggccggccgcctcgatacgcaaaacctcggaggacgctga

DBGET integrated database retrieval system