KEGG   Burkholderia cenocepacia H111: I35_4037Help
Entry
I35_4037          CDS       T03804                                 

Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: CDN61873
LinkDB All DBs
Position
2:complement(40712..41245)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDEGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacatcccggcgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcatcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtccgggaaatggggctacctggaacacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgaaggccacacgctcgtcgcgttc
gatcaccccgagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgaaggcaatcccgacggctacttcgacgtgcactcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcgatcgagaagctgttccgctga

DBGET integrated database retrieval system