KEGG   Burkholderia cenocepacia H111: I35_4045Help
Entry
I35_4045          CDS       T03804                                 

Definition
(GenBank) hypothetical protein
Organism
bceo  Burkholderia cenocepacia H111
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3304
Motif
Other DBs
NCBI-ProteinID: CDN61881
LinkDB All DBs
Position
2:51144..51821
Genome map
AA seq 225 aa AA seqDB search
MNRCWITLLSVMVFSTAACSKSVNDAEKDSLAPGEVNKWNDPNYDIITAGSFNYTDYDIY
GVYLLPPDKNSLDDAASADGAHATPRNAKYWSGGGGSRPSLAWDFRWKTPKTFKVWWERV
VDKRAMEASSANYDPYTHRETQPGMAWCEGEITVTRPPVKDKSGGIVLHFFPDGRVEGDM
DFEVDGPDPKVALSKRDAQRKLADRACLKEIPNPFYGRKKPAQWN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgctgctggatcaccttgctgtccgtgatggttttctccacggctgcctgcagc
aagagcgtgaacgatgccgaaaaggacagcttggcgccgggcgaagtgaataaatggaac
gacccgaactacgacatcattaccgccgggtccttcaactatacggattacgacatctac
ggcgtctatctgctgccgcccgacaagaacagcctcgacgacgcggcgagcgccgacggc
gcgcacgccacgccccggaatgcgaagtactggtccggcgggggcggctcgcgcccgagt
ctcgcgtgggatttccgctggaagaccccgaagacgttcaaggtgtggtgggagcgcgtg
gtcgacaagcgcgcgatggaagcgtcgtccgcgaactacgacccgtacacgcaccgggaa
acccagccggggatggcgtggtgcgaaggcgagatcacggtcacgcggccgcccgtcaag
gacaagagcggcggcatcgtgctgcacttcttccccgatggccgggtggaaggcgacatg
gatttcgaagtcgacggcccggacccgaaggtggccctgtccaagcgtgacgcgcagcgc
aagctggccgaccgcgcgtgcctgaaggaaattcccaatccgttctatgggcgcaagaag
ccggcccagtggaattga

DBGET integrated database retrieval system