KEGG   Burkholderia cenocepacia H111: I35_7432
Entry
I35_7432          CDS       T03804                                 

Definition
(GenBank) Coenzyme F390 synthetase
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
bceo  Burkholderia cenocepacia H111
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I35_7432
Enzymes [BR:bceo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     I35_7432
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: CDN64989
LinkDB
Position
3:complement(498392..499627)
AA seq 411 aa
MSERTTRFDSSAVSEALSYDARYADLLPTGVASYAAFRALVGIETADDLKRRVLERLEHG
DLAGATFYTTSGTSGEVKLLLNAPARKRPDATYGRALANALAGTAIAPTDRVANLFTAGG
FSTLYDGVNRLLEAIGANVLPIGRLDAYGADLPAMLNLIGRVRPNVLVGTPTSVLQCLRL
LDAYGVDLDVTTILYTGEAFSGHKREIVRRRWRDAAFFGLYGATETGFLGYHTPRCAEGH
YHVLDDWFFLEEEDGQLLVTSRANPGLAMLRYRIGDRVRVGPAVRCTCGEGGSVVVLQGR
TDQRFKFAGNLISTELLAQRLAACAGRPLDSQFRLAADAHGRDCLTVALDLDDDEFAPLG
PRLTRTLLEIEDVRECIDKGEGRLDVRGRDALRFSARQKLPRLIDERHAHV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtccgagcgcacgacccgcttcgattcctccgccgtgagcgaagcgctttcgtacgat
gcccgctatgcggatttactgccgacgggcgtggccagctacgcggccttccgcgcgctg
gtcgggatcgagacggccgacgacctgaagcggcgcgtactggagcgcctcgagcacggc
gatctcgccggcgcgacgttttacaccacgtcgggcacgagcggcgaggtcaagctgctg
ctcaatgcgccggcccgcaagcggcccgacgcgacttatggccgggcgctcgcgaatgcg
ctggcggggacagcgatcgcaccgacggaccgggtggcgaacctgtttaccgccggcggc
ttttccacgctgtacgacggcgtgaaccggttgctggaagcgatcggcgcgaacgtgctt
ccgatcgggcggctggacgcatacggcgccgatcttcccgccatgctgaacctgatcggc
cgcgtgcgccccaacgtgctggtcggcacgccgacgagcgtgctgcaatgcctgcggctg
ctcgacgcgtacggcgtggatctcgacgtgacgacgatcctctacaccggcgaagcattc
tctgggcacaagcgcgagatcgtgcggcggcgctggcgcgatgccgcattcttcggactg
tacggcgccaccgaaacggggtttctcggctatcacacgccgcgctgtgcggaagggcat
taccacgtgctcgacgactggttctttctcgaagaggaggacgggcaactcctcgtgacg
agccgtgccaacccgggcctcgcgatgctgcgctaccggatcggcgatcgcgtgcgcgtc
ggtccggcggtgcgctgtacgtgtggcgagggcggttccgtcgtcgtgctgcagggccgc
acggatcagcgcttcaagttcgcgggcaacctgatcagcacggagctgcttgcgcagcgg
ctcgcggcgtgcgccggccggccgctcgacagtcagtttcgcctggccgccgacgcgcat
ggacgcgattgtctgacggtcgcgctggacctggacgacgatgaattcgcgccgctcggg
ccacggctcacccgtacgctgctcgagatcgaggacgtgcgcgagtgcatcgacaagggc
gaggggcgcctcgacgtgcgcggccgcgatgccttgcgcttctccgcacgccagaagctc
ccgcgcctgatcgacgagaggcacgcccatgtgtga

DBGET integrated database retrieval system