KEGG   Burkholderia cenocepacia H111: I35_7568Help
Entry
I35_7568          CDS       T03804                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bceo  Burkholderia cenocepacia H111
Pathway
bceo00500  Starch and sucrose metabolism
bceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bceo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I35_7568
Enzymes [BR:bceo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     I35_7568
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     I35_7568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: CDN65125
LinkDB All DBs
Position
3:643098..646511
Genome map
AA seq 1137 aa AA seqDB search
MMKREDSLDDVRRAQFPSLAPAGTPRRRRARRREPALCADDPLWYKDAIIYQVHVKSFYD
SNNDGIGDFPGLIAKLDYIAELGVDTIWLLPFYPSPRRDDGYDIADYRDVHPDYGTLADV
RRFIREAHARGIRVIAELVINHTSDQHPWFQRARRAKPGSTHRDYYVWSDTDTKYAGTRI
IFLDTETSNWTHDPVAGQYYWHRFYSHQPDLNFDNPAVVREVIQVMRFWLDLGIDGLRLD
AVPYLVEREGTNNENLPETHAILKRIRATIDAEYPNRMLLAEANQWPEDVQEYFGNEDEC
HMAFHFPLMPRIYMSIASEDRFPIVDIMRQTPALAPSNQWAVFLRNHDELTLEMVTDSER
DLLWQTYASDRRARLNLGIRRRLAPLMERDRRRIELINSLLLSMPGTPVIYYGDELGMGD
NIHLGDRDGVRTPMQWSSDRNGGFSRADPELLVLPPVMGSLYGYDAINVEAQTRDPHSLL
NWTRRILATRRASQAFGRGTIRFLRPENRKVLAYLRELDGHEPVLCVANLSRASQAVELD
LSEFAGRVPIEMTSDSPFPPIGQLPYLLTFPPYGFLWFVLAEHGREPSWRQPHAEPLPEY
VTLVMRRGDTRPDVSQLHALAHDALASWLARRRWFASKDRKIGDAWLNVVTPIPDEPFQY
AEAWVSASDGGAERYVVPLAAAWGGETSNPLFTQLALARVRRGHTVGYLTDAFALPAFAR
GMLRKLRVGATVLTSDGGRLTFLPENALAGLDPGDDAEVRWLAAEQSNSSLVIGDTIVLK
LVRKVAHGIHPEAEMSRHLTRIGYANTATLAGEVVHVDPDGTPHTVAILQRYVDNQGDAW
TRSFDFLRRAIDELALPAADEGEAAETGEEPDALLGYAAFAGIIGTRLGQLHVALAQPSD
DPAFAPERATPEHVDSWCVDAIASFERALDVLRTRLDALDPTTRASADALLASRDAAVQA
LGELVPRTLDAQCTRIHGDFHLGQVLDVQGDALLIDFEGEPARPLERRRAKSHPLRDVAG
LLRSLSYVSATAQFAIEKAPPQAAGRKRALFDRFGQAAADRFVECYRAAADLAPARFVDP
HYADRLLALFLIDKASYELCYEAANRPDWLSVPVGGLAALVDRLLGDGVLPDDGGNP
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacgcgaagattccctcgacgacgtgcggcgcgcgcagtttccgtcgctcgcg
ccggccggcacgccgcgccggcgccgcgcgcgccgccgcgaacccgcgctctgcgcggac
gatccgctgtggtacaaggacgcgatcatctaccaggtgcacgtgaagtcgttctacgac
tcgaacaacgacggcatcggcgatttccccggcctgatcgcgaaactcgactacatcgcg
gaactcggcgtcgacacgatctggctgctgccgttctatccgtcgccgcgccgcgacgac
ggctacgacatcgccgactatcgcgacgtgcatcccgactacggcacgctggccgacgtg
cggcgcttcatccgcgaagcgcatgcgcgcggcatccgcgtgatcgccgaactcgtgatc
aaccacacgtcggaccagcatccgtggttccagcgcgcgcgccgcgcgaagccgggctcc
acgcatcgcgactactacgtgtggtccgacaccgacacgaaatacgcgggcacgcgaatc
atctttctggataccgaaacgtcgaactggacccacgacccggtggccggccagtattac
tggcaccgcttctattcgcaccagcccgacctgaacttcgacaacccggccgtcgtgcgc
gaagtgatccaggtgatgcgcttctggctcgacctcggcatcgacgggctgcggctcgac
gcggtgccgtacctggtcgagcgcgaaggcaccaacaacgagaacctgccggagacgcac
gcgatcctgaagcggatccgcgcgacgatcgacgccgagtacccgaaccggatgctgctc
gcggaagcgaaccagtggccggaagacgtgcaggaatacttcggcaacgaggacgaatgc
cacatggcgttccacttcccgctgatgccgcgcatctacatgtcgatcgcgagcgaggat
cgcttcccgatcgtcgacatcatgcggcagaccccggcgctcgcgcccagcaaccagtgg
gccgtgttcctgcgcaatcacgacgagctgacgctcgagatggtcaccgattcggagcgc
gacctgctgtggcagacctacgcgagcgaccggcgcgcgcggctgaacctcggaatccgg
cgccggctcgcgccgctgatggagcgcgaccggcgccgcatcgagctgatcaattcgctg
ctgctgtcgatgccgggcacgccggtgatctattacggcgacgagctcgggatgggcgac
aacatccacctcggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgtcggaccgc
aacggcggcttctcgcgcgccgaccccgaactgctcgtgctgccgccggtgatgggctcg
ctgtacggctatgacgcgatcaacgtcgaggcgcagacgcgcgatccgcattcgctgctg
aactggacgcgccgcattctcgcgacgcgccgcgcgtcgcaggcgttcgggcgcggcacg
atccgcttcctgcgcccggaaaaccgcaaggtactcgcgtacctgcgcgaactcgacggc
cacgagccggtgctgtgcgtcgcgaacctgtcgcgcgcgtcgcaggcggtggaactcgac
ctgtccgaattcgcgggccgcgtgccgatcgagatgacgtccgattcgccgtttccgccg
atcggccagctcccgtatctcctcaccttcccgccgtacgggttcctgtggttcgtgctc
gccgagcacggccgcgagccgtcgtggcggcagccgcacgcagagccgctgcccgaatac
gtgacgctggtgatgcggcgcggcgatacgcggccggacgtctcgcagctgcacgcgctc
gcgcacgacgcgctcgcgtcgtggctcgcgcggcggcgctggttcgcgtcgaaggatcgc
aagatcggcgacgcgtggctgaacgtcgtcacgccgattccggacgagccgttccagtac
gcggaggcgtgggtgtcggcgagcgacggcggcgcagaacgctacgtcgtgccgctcgcg
gccgcgtggggcggcgagacgtccaatccgctgttcacgcagctcgcgctggcgcgcgtg
cggcgcggccatacggtcggctacctgaccgacgcgttcgcgctgccggcgttcgcgcgc
gggatgctgcgcaagctgcgcgtcggcgcgacggtgctcacgtccgacggcggccggctc
acctttctgccggaaaacgcgctcgccgggctcgacccgggcgacgacgcggaagtgcgc
tggctcgcggccgagcagagcaacagctcgctcgtgatcggcgacacgatcgtgctgaaa
ctggtgcgcaaggtcgcgcacggcattcacccggaagcggaaatgagccggcacctgacg
cgcatcggctatgcgaacaccgcgacgctggccggcgaggtcgtgcacgtcgatccggac
ggcacgccgcacacggtcgcgatcctgcagcgctatgtcgacaaccagggcgacgcatgg
acgcgttcgttcgatttcctgcgccgcgcgatcgacgagctcgcgctgccggccgcggac
gaaggcgaggcggccgaaacgggcgaggaacccgatgcgctgctcggctatgcggcgttc
gcgggcatcatcggtacgcggctcggccagttgcacgtcgcgctcgcgcagccgtccgac
gatcccgcgttcgcgccggagcgcgcgacgcccgaacacgtcgacagctggtgcgtcgat
gcgatcgcgtcgttcgagcgcgcgctcgacgtgttgcgcacgcggctcgacgcgctcgat
ccgaccacccgtgcgtcggccgatgcgctgctcgcgtcgcgcgacgcggccgtgcaggcg
ctcggtgaactcgtgccgcgcacgctcgatgcgcaatgcacgcggattcacggcgatttt
catctgggccaggtgctcgacgtgcagggcgacgcgctgctgatcgacttcgaaggcgaa
ccggcgcgcccgctcgagcggcggcgcgcgaaatcgcatccgctgcgcgacgtggccggc
ttgctgcgctcgctgtcgtacgtgagcgcgaccgcgcagttcgcgatcgaaaaagcgccg
ccgcaggccgccggccgcaagcgcgcgctgttcgaccgcttcgggcaggcggccgccgac
cgcttcgtcgaatgctatcgcgcggcggccgacctcgcgcccgcgcgcttcgtcgatccg
cactatgcggaccgcctgctcgcgctgttcctgatcgacaaggcgtcgtacgagctgtgc
tacgaagccgcgaaccggcccgactggctgagcgtgccggtcggcgggctcgcggcgctg
gtcgaccgcctgctcggcgacggcgtgctgcccgacgacggaggaaacccatga

DBGET integrated database retrieval system