KEGG   Burkholderia cepacia ATCC 25416: APZ15_00535Help
Entry
APZ15_00535       CDS       T04772                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00020  Citrate cycle (TCA cycle)
bcep00480  Glutathione metabolism
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01120  Microbial metabolism in diverse environments
bcep01130  Biosynthesis of antibiotics
bcep01200  Carbon metabolism
bcep01210  2-Oxocarboxylic acid metabolism
bcep01230  Biosynthesis of amino acids
Module
bcep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcep_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APZ15_00535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APZ15_00535
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     APZ15_00535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALK16410
UniProt: A0A088TDT7
LinkDB All DBs
Position
1:complement(114901..116157)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggaaggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggttgtcgacgcggcggtcgcgcacgcctacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgacgaaggtgtac
ggcccggacgtgtggctcccggacgaaacgctgcaggtgctcaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggaactcgacctgtacgtgtgtctgcgcccggtgcagtacttcaagggcgtgccg
tcgccggtgcgcgagccgcaaaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggccgcgggttccgagcaggcgaagaaggtcatcaagttc
ctgcaggacgagatgggcgtgaagaagatccgctttccggaaacctcggggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctggcgcagaaggaattcggcggcgagctgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtcatcaag
gattcgattgccgatgcgttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgccacgctgaacctgaacggcgactacatctccgacgcactggccgcgcaggtcggc
ggcatcgggatcgcgccgggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcaccgaagtacgcgggcaaggattacgtgaacccgggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcagccgacacgatcatcgcc
gcgatggagaagtcgatcctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggtgcgacgcaggtgtcgtgctcgggcttcggtgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system