KEGG   Burkholderia cepacia ATCC 25416: APZ15_02625Help
Entry
APZ15_02625       CDS       T04772                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APZ15_02625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcep02000]
    APZ15_02625
Enzymes [BR:bcep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APZ15_02625
Transporters [BR:bcep02000]
 Other Transporters
  Pores ion channels [TC:1]
   APZ15_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ALK16794
UniProt: A0A088TG94
LinkDB All DBs
Position
1:580672..581286
Genome map
AA seq 204 aa AA seqDB search
MKLYYWPKTRAFRALWMLEELGVVYELVPIDLRSHEQGSDAFVQVNPMAKLPALDDGSVP
FAESGAVLLYLADRCPGAGLGIAPDDPLRGRFLQWMFFTPTCLEPAMAEKFTGASGNPVA
FGWGNITRVQRALAQALAHHPWLVGDRFTAADLLLASTLKIAFDAHLLPHEGVLGDYVAR
AEDRDAFRRAVAIEQREAARLLHA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactactggccgaagacccgggcattccgggcgttgtggatgctcgaagag
ctcggtgtggtgtacgaactcgtgccgatcgacctgcgctcgcacgaacagggcagcgat
gcgttcgtgcaggtcaacccgatggccaagctgcccgcgctcgacgacggcagcgtgccg
ttcgccgaatcgggcgccgtgctgctctatctcgccgaccgctgcccgggtgccgggctc
ggcatcgcgcccgacgatccgctgcgcggccgctttctccaatggatgttcttcacgccg
acctgcctcgaaccggcgatggccgaaaaattcaccggcgcgtcgggcaatccggtcgca
ttcggctggggcaacatcacgcgcgtgcaacgcgcactcgcgcaagcgctcgcccatcat
ccatggctcgtcggcgaccgcttcaccgcggccgacctgctgctcgccagcacgctgaag
atcgcgttcgacgcgcatctgctgccgcacgaaggcgtgctcggcgactatgtcgcgcgc
gccgaggaccgcgacgcattccgccgcgcggtcgcgatcgaacagcgcgaagcggcgcgc
ctgctgcatgcgtga

DBGET integrated database retrieval system