KEGG   Burkholderia cepacia ATCC 25416: APZ15_03455Help
Entry
APZ15_03455       CDS       T04772                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00970  Aminoacyl-tRNA biosynthesis
bcep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    APZ15_03455
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bcep03029]
    APZ15_03455
Enzymes [BR:bcep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     APZ15_03455
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     APZ15_03455
Mitochondrial biogenesis [BR:bcep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    APZ15_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase YcaO
Motif
Other DBs
NCBI-ProteinID: ALK16948
LinkDB All DBs
Position
1:complement(752590..754080)
Genome map
AA seq 496 aa AA seqDB search
MHAKSLTELRAALAAKECSAVELAQLYLKRIDAARDLNAFVHVDADLTLAQAKAADAELA
RGAGGALTGLPIAHKDVFVTRGWHSTAGSKMLANYASPFDATVVARLQAAGMVTLGKTNM
DEFAMGSSNENSAFGAVKNPWDTNAVPGGSSGGSSAAVAARLAPAATGTDTGGSIRQPAS
FAGVTGIKPTYGRVSRYGMIAFASSLDQGGPMAQSASDCALLLNAMAGFDERDSTSLDRD
DEDFTRHLGQPWAAGNDAGKPLAGLRIGLPNEYFGDGLADDVRATIDAALKQYEALGATL
VPVSLPKTELSIPVYYVIAPAEASSNLSRFDGVRFGHRAAQYGDLLDMYKKSRAEGFGPE
VKRRILVGTYVLSHGYYDAYYLQAQKIRRIIANDFQEAFKTCDVIMGPASPTVAWDLGSK
GDDPVQMYLADIYTLSVSLAGLPGMSVPCGFGAGANAKRPVGLQIIGNYFNEARMLQVAD
AFQRATDWHKQVPAGV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaaaagcctgaccgaactgcgcgccgcgctcgccgccaaggaatgctcggcc
gtcgagctcgcgcagctctacctgaaacggatcgacgccgcgcgcgacctgaacgcgttc
gtccacgtcgatgccgacctgaccctcgcgcaggcgaaagctgccgacgcggagctcgcg
cgcggcgcgggcggcgcgctcaccggcctgccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcactcgaccgccggctcgaagatgctcgcgaactacgcgagcccgttcgac
gcgaccgtcgtcgcccgcctgcaggcggccggcatggtcacgctcggcaagaccaacatg
gacgagttcgcgatgggctcgtcgaacgagaactcggcgttcggcgcggtgaagaacccg
tgggacacgaacgcggtgccgggcggcagctcgggcggcagttcggccgccgtcgccgcg
cgcctcgcgccggcggcaaccggcaccgacaccggcggctcgatccgccagcccgcgtcg
ttcgcgggcgtgacgggcatcaagccgacctacggccgcgtgtcgcgctacgggatgatc
gcgttcgcgtcgtcgctcgaccagggcggcccgatggcgcagagcgcgtccgactgcgcg
ctgctgctgaacgcgatggccggcttcgacgagcgcgactcgacgagcctcgatcgcgac
gatgaagatttcacgcgccacctcggccagccgtgggcggccggcaacgatgcgggcaag
ccgctcgcgggcctgcgcatcggcttgccgaacgagtatttcggcgacggcctggccgac
gacgtacgcgcgacgatcgacgcggcactgaagcagtatgaagcgctcggcgcgacgctc
gtgcccgtgtcgctgccgaagacggagctgtcgatccccgtgtattacgtgatcgcgccg
gccgaggcatcgtcgaacctgtcgcgtttcgacggcgtgcgtttcggccaccgcgccgcg
caatacggcgacctgctcgacatgtacaagaagtcgcgcgcggaaggcttcggccccgag
gtgaagcgccggatcctggtcggcacgtacgtgctgtcgcacggctactacgacgcgtac
tacctgcaggcgcagaagatccgccgcatcatcgcgaacgatttccaggaagcgttcaag
acctgcgacgtgatcatgggcccggcttcgccgacggtcgcatgggatctcggttcgaag
ggcgacgatccggtgcagatgtatctcgcggatatctacacgctgtcggtgagcctcgcg
ggcctgcccggcatgagcgtgccgtgcggcttcggcgcgggcgcgaacgcgaagcgcccg
gtcggcctgcagatcatcggcaactatttcaacgaagcccggatgctgcaggtcgccgac
gcgttccagcgcgcgaccgactggcacaagcaagttccggcaggggtgtaa

DBGET integrated database retrieval system