KEGG   Burkholderia cepacia ATCC 25416: APZ15_13655Help
Entry
APZ15_13655       CDS       T04772                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bcep  Burkholderia cepacia ATCC 25416
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2007
Motif
Other DBs
NCBI-ProteinID: ALK18761
UniProt: A0A088TZ24
LinkDB All DBs
Position
1:complement(2963136..2964572)
Genome map
AA seq 478 aa AA seqDB search
MKIYDQFYIDGAWRKPAGTGTIDVIDSGTEAVIGRIPEGVASDAQDAIRAARAAFDAWAA
TPASTRAGYLRKLVEHLQARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWKAYAKLAES
FEFEAQVGNSLVVREPVGVVAAITPWNYPLNQVTLKVAPALAAGCTVVLKPSEVAPLNAF
MLAEAIHEAGLPAGVFNLVCGYGPVVGEVLATDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVNACYLNAGQTCSAHTRMLVPEARYDEARAIAK
AAAESYVAGDPRQDATRLGALASAVQQQRVQDYIQRGIDEGAELVTGGTGLPEGLRKGFF
VKPTVFGRVDPKSTIAQEEIFGPVLSIITYRDEDEAVRIANDSPYGLGGAVWAGSDERAM
GIARRIRTGQVDINGGTWNGAAPFGGYKQSGHGRENGVYGLEEYLEYKSMQLKPAKPA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacgaccagttctatatcgacggcgcgtggcgcaagccggccggcaccggc
acgatcgacgtgatcgactcgggcaccgaagccgtgatcggccggattccggaaggcgtc
gcgtccgacgcgcaggacgcgatccgcgcggcgcgcgcggccttcgacgcgtgggcggcc
acgccggcctcgacgcgcgcgggctacctgcgcaagctcgtcgagcatctgcaggcgcgc
agcgaggagctcgcgcagtcgatcaccggcgaagtcgggatgccgatcaagctgtcgcgc
gcgatccaggtcggcggcccgatctacaactggaaggcgtacgcgaagcttgccgagtcg
ttcgagttcgaggcacaggtcggcaactcgctcgtcgtgcgcgagccggtgggtgtcgtc
gcggcgatcacgccatggaactacccgctcaaccaggtgacgctgaaggtcgccccggcg
ctcgccgccggctgcacggtcgtcctgaagccgtccgaagtcgcaccgctcaacgcgttc
atgcttgccgaagcgattcacgaagccgggctgccggccggcgtgttcaacctcgtgtgc
ggctacggcccggtggtcggcgaggtgctggccaccgatccggacgtcgacatggtgtcg
tttacgggctcgacgcgcgccggcaagcgcgtggccgagctggcggccgcgggcgtcaag
cgcgttgcgctcgagctcggcggcaagtcggcgtcggtgatcctcgacgatgccgatttc
gcggcggcggtgaagggcacggtcaacgcgtgctacctgaacgcggggcagacctgctcg
gcgcatacacggatgctggtgccggaagcccgctacgacgaagcgcgcgcgatcgcgaag
gccgcggccgaatcgtacgtcgcgggcgacccgcggcaggatgcgacgcgtctcggcgcg
cttgcgtcggccgtgcagcagcagcgcgtgcaggactacatccagcgcgggatcgacgaa
ggcgcggagctcgtgacgggcggcacgggcctgccggaagggctcaggaagggcttcttc
gtgaagccgaccgtgttcggccgcgtcgatccgaaatcgacgatcgcgcaggaagaaatc
ttcgggccggtgctgtcgatcatcacgtatcgcgatgaggacgaggccgtgcggatcgcg
aacgattcgccgtacgggctcggcggcgcggtgtgggccggcagcgacgagcgcgcgatg
ggcatcgcgcgccgtatccgcaccgggcaggtggacatcaacggcggcacgtggaacggc
gccgcgccgttcggcggctacaagcagtcggggcatggccgcgagaacggcgtgtacggg
ctcgaggaatatctcgagtacaagtcgatgcagctcaagcccgcgaagcctgcctga

DBGET integrated database retrieval system