KEGG   Burkholderia cepacia ATCC 25416: APZ15_14690Help
Entry
APZ15_14690       CDS       T04772                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00220  Arginine biosynthesis
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01130  Biosynthesis of antibiotics
bcep01210  2-Oxocarboxylic acid metabolism
bcep01230  Biosynthesis of amino acids
Module
bcep_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    APZ15_14690
Enzymes [BR:bcep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     APZ15_14690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ALK18949
LinkDB All DBs
Position
1:3187351..3188571
Genome map
AA seq 406 aa AA seqDB search
MSTLDATAPSTDTQGDASLVSLPWIKQLVSMDTTSRVPNLGLIETVRDALAAKGIASTIT
HDPREGWANLFATVPAHDGSTNGGIVLSGHTDVVPVDGQQWDSNPFAPEIRDGRLYGRGT
CDMKGFIGAALALLPEMQATKLAKPIHFALSYDEEIGCAGAPLMIADLVKRGVQPSGCIV
GEPTSMRPIIAHKGINAYRCCVRGHAAHSSLTPKGLNAIEYAARLICHIRDIADRFRAEG
PFDALYDVPFTTAQTSTIQGGNAINTVPAECRFDFEFRNLPTLDPEQIFTRIEAYARETL
LPQMLREHPNAAIEFSKIAAAPGLDATEQAAITQLVRALTADQDKRKVAYGTEAGLFERA
GIPSVVCGPGNIEQAHKPNEYVELAQLAGCEQFLRKFIHSMSVDAH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctcgacgccacggcgccgtccaccgacacccaaggcgacgcgtcgctcgtc
agcctgccctggatcaagcaactggtgtcgatggacacgacgagccgcgtgccgaacctc
ggcctgatcgaaacggtgcgcgacgcgctcgccgcgaaaggcatcgcctcgacgatcacg
catgatccacgcgaaggctgggcgaacctgttcgcgaccgtgcccgcgcacgacggctcg
acgaacggcggcatcgtgctgtcggggcataccgacgtcgtgccggtcgacggccagcaa
tgggacagcaacccgttcgcgccggaaatccgcgacggccgcctgtacggccgcggcacc
tgcgacatgaagggtttcatcggcgccgcgctcgcgctgctgcccgagatgcaggcgacg
aagctcgcgaagccgatccatttcgcgctgtcctacgacgaggaaatcggctgcgccggc
gcgccgctgatgatcgccgacctcgtcaagcgcggcgtgcaaccgtcgggctgcatcgtc
ggcgagccgaccagcatgcggccgatcatcgcgcacaagggcatcaacgcataccgctgc
tgcgtgcgcggccatgcggcgcactcgtcgctgacgccgaaggggctgaacgcgatcgag
tatgcggcgcgcctcatctgccacatccgcgacatcgccgaccgcttccgcgccgaaggc
ccgttcgacgcgctgtacgacgtgccgttcacgaccgcgcagacgagcacgatccagggc
ggcaacgcgatcaacacggtgccggccgagtgccgcttcgacttcgaattccgcaacctg
ccgacgctcgatcccgagcagatcttcacgcgcatcgaagcgtatgcacgggaaacgctg
ctgccgcagatgcttcgtgagcatccgaatgccgcgatcgaattttcgaagatcgccgcg
gcgcccggcctcgacgcaaccgaacaggccgcgatcacgcaactcgtgcgcgcgctgacg
gcggaccaggacaagcgcaaggtcgcatacggcaccgaggccggcctgttcgaacgcgcg
ggcatcccgagcgtcgtatgcgggcccggcaacatcgagcaggcgcacaagccgaacgaa
tatgtcgagctcgcgcagctcgccggctgcgagcagttcctgcgcaagttcatccacagc
atgtcggtcgacgcgcactga

DBGET integrated database retrieval system