KEGG   Burkholderia cepacia ATCC 25416: APZ15_15160Help
Entry
APZ15_15160       CDS       T04772                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00473  D-Alanine metabolism
bcep01100  Metabolic pathways
bcep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcep00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    APZ15_15160
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    APZ15_15160
Enzymes [BR:bcep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     APZ15_15160
Peptidoglycan biosynthesis and degradation proteins [BR:bcep01011]
 Precursor biosynthesis
  Racemase
   APZ15_15160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALK19038
UniProt: A0A088U7M9
LinkDB All DBs
Position
1:complement(3290233..3291303)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARAFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYLPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ENIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSSDIADTGLKPAMTLASELI
AVQTIAKGQAIGYGSTFSAQAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVAGRVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccacaccgccgctctcgcgaacaatctctccgtc
gtccgccgctttgccggcccgtccaaggtctgggcggtcgtcaaggcgaacgcgtacggg
cacggtctcgcccgcgcgtttccgggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggcagtcaagctgcgcgagctcggctgggccggcccgatcctgctgctggag
gggttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgacgacgaccgtc
cacaacgacgagcagatgcggatgctggaaacggcgcggctgtcgaaacccgtcaacgtg
cagctgaagatgaacagcgggatgaaccggctcggctacctgccggagaaataccgcgcc
gcgtgggagcgcgcccgcgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggatgcggacaacgagcgcggcgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaaacatcgccggcgcgcgcagtctcgcgaactcggccgccgtgctgtggcatccggac
acgcatttcgactgggtgcgcccggggatcgtgctgtacggcgcgtcgccgtcggggctg
tcgtccgacatcgccgacacggggctgaagccggcgatgacgctcgcgtccgaactgatc
gcggtgcagacgatcgcgaagggccaggcgatcggctacggctcgacgttttccgcgcag
gcgccgatgcggatcggcgtggtcgcatgcggttatgcggacggttatccgcgggtcgcg
cccgaaggcacgcccgtgatcgtcgacggcatccgcacgcggatcgtcggtcgcgtgtcg
atggacatgattaccgtcgacctgaccccgtgcccgcaagccggcgtcggcgcgcgtgtc
gagctgtggggcaatgcattgccgatcgacgacgtcgcccgccattgcggcacgatcggt
tacgagctgatgtgtgcagtcgccggccgtgtgcccgtgcgcgcggaataa

DBGET integrated database retrieval system